KEGG   Oryctolagus cuniculus (rabbit): 100349338
Entry
100349338         CDS       T03373                                 
Symbol
IL20RB
Name
(RefSeq) interleukin 20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349338 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349338 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100349338 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349338 (IL20RB)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL10/28 receptor family
   100349338 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 100349338
NCBI-ProteinID: XP_017202286
Ensembl: ENSOCUG00000016131
LinkDB
Position
14:30710219..30743891
AA seq 304 aa
MVLEDICTSLVLWFFALIPCLLTDGVAILPAPSNLSVHSANMKHLLVWSPVALPGETVYY
SVQYQGEYESLYRSHVWIPSSLCSLTERPQCDVSDDITATVPYNLRVRATLGSRTSAWST
LKQPFNRNSTVLTPPVVAISKDGFHLVIELEDLGPHFEFLVAYWRREPGAKEHLKVLRNE
GVPVHLATMEPGAAYCVKAQTFVKAIQRHSAFSQPECVEVRGEALPLALALFAFVGFMLI
LAVVPLSVWKMGQLLQYSCCPAVVLPDTLKITSSAQKLITCRRDDEDACATAVLSAEELC
GVWL
NT seq 915 nt   +upstreamnt  +downstreamnt
atggttctggaagacatttgcacaagtcttgtcctgtggttcttcgctctgattccatgt
ttgctcacagatggagtggccattctgcctgccccttcgaacctctcagtacactcagcc
aacatgaagcatctcttggtgtggagcccagtggccttgcctggagaaacagtgtactat
tctgtccagtaccagggggagtacgagagcctgtacaggagccacgtgtggatccccagc
agcttgtgctcgctcactgaaaggcctcagtgcgacgtgagcgacgacatcaccgccaca
gtgccgtacaacctccgtgtcagggccacgctgggctcacggacctcagcctggagcacc
ctgaagcagcccttcaatcgaaactcaacggtcctcacgccccctgtggtggcgatctcc
aaggatggctttcacctggtgatcgagctggaagacctggggccgcactttgagttcctc
gtggcctactggaggagggagcctggcgccaaggaacacctcaaagtgctccggaatgag
ggtgtcccggtgcacctggccaccatggagcctggggccgcgtactgtgtgaaggcgcag
acatttgtgaaggccatccagaggcacagcgccttcagccagccagaatgcgtcgaggtg
cgaggagaggctctcccgctggcgctcgccctgtttgcattcgtgggcttcatgctgatc
cttgcggtggtgccgctgtccgtctggaaaatgggccagctgctccagtattcctgctgc
cctgcggtggtcctcccggacaccttgaagataaccagttcagcccagaagttgatcacg
tgcagaagggacgatgaggacgcctgcgccacggctgtgctgtctgccgaggagctctgc
ggggtgtggctgtag

DBGET integrated database retrieval system