KEGG   Oryctolagus cuniculus (rabbit): 100349367
Entry
100349367         CDS       T03373                                 
Symbol
CNTFR
Name
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349367 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349367 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349367 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100349367 (CNTFR)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100349367 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Receptors
  100349367 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 Ig_5 MAGI_u5
Other DBs
NCBI-GeneID: 100349367
NCBI-ProteinID: XP_008271254
Ensembl: ENSOCUG00000000355
LinkDB
Position
1:19244434..19274978
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYTQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGDPGSGGGPSAPFLLSVPITLAL
AAAAATASSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgccgccgccgctgctgttgtc
tacacccagagacacagtccacaggaggcaccccatgtgcagtacgaacgcctgggctca
gatgtgactctgccgtgcgggacagcgaactgggatgcagctgtgacatggcgggtgaat
ggcacagacctggcccctgacctgctgaacggctctcagctcgtgctccgcggcctggaa
ctgggccacagtggcctttacgcctgcttccaccgtgactcctggcacctgcgccaccag
gtcctgctgcatgtaggcttgccgccgcgggagcccgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacatacatccccaacacc
ttcaacgtgaccgtgctgcacggctccaaaattatggtctgcgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggccacaacgccacggcaatcacctttgacgagttcacc
attgtgaagcctgaccctccagagaacgtggtcgcccggcccgtgcccagcaaccctcgc
cgcctggaggtgacgtggcagaccccctcgacctggcccgaccccgagtccttccctctc
aagttcttcctgcgctaccgacccctcatcctggaccagtggcagcacgtggagctgtca
gatggcaccgcgcacaccatcacggatgcctatgctgggaaggagtacatcatccaggtg
gcggccaaggacaacgagatcgggacgtggagcgactggagcgtggctgcccatgccacg
ccctggacggaagagccacgacacctcaccaccgaggcccaggccccggagaccacgacc
agcaccaccagctcactggcgcccccacccaccacgaagatctgtgaccctggggacccg
ggcagcggcggcggaccctcggcgcccttcctgctcagcgtccccatcactctggccctg
gctgccgctgccgccactgccagcagtctcctgatctga

DBGET integrated database retrieval system