KEGG   Oryctolagus cuniculus (rabbit): 100349404
Entry
100349404         CDS       T03373                                 
Symbol
RNF125
Name
(RefSeq) ring finger protein 125
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100349404 (RNF125)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100349404 (RNF125)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100349404 (RNF125)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100349404 (RNF125)
SSDB
Motif
Pfam: zf_C2HC_14 zf-Di19 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 U-box zf-Nse zf-RING_10 zf-RING_6 Rad50_zn_hook zf-rbx1 zf-RING_11 DZR
Other DBs
NCBI-GeneID: 100349404
NCBI-ProteinID: XP_008259402
LinkDB
Position
9:73318649..73367227
AA seq 232 aa
MGSVLSSDSGKSAPSSATPRALERKGDPELPVTSFDCSVCLEVLHQPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYQNCTECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELVETATRCVCPFCQRELDEDSLLDHCITHHRSERRPVFCPLCRLVPNEN
ANSFNGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSSTT
NT seq 699 nt   +upstreamnt  +downstreamnt
atgggctccgtgctgagcagtgacagcggcaagtctgcgccctcctctgccacccctcgg
gccttggaacgcaagggggacccggagttgcccgtcacgtccttcgactgctcggtgtgc
cttgaggtgttgcaccagcctgtccggactcgctgtggccacgtattctgccgttcctgt
attgctaccagtctaaagaacaataagtggacctgtccttattgccgggcatatctgcct
tcagaaggagttccagcaactgatgtagccaagagaatgaaatcagaataccagaactgc
actgagtgtgacaccctggtttgcctcagtgagatgagagcgcacataaggacttgtcag
aagtacattgataagtatggaccactacaagaacttgtggagacagcaacaaggtgtgta
tgtccattttgtcagagggagttggatgaagacagcctgctggatcattgtattactcat
cacagatcagaaaggaggcctgtgttctgtccactttgccgtttagtacctaacgagaat
gcaaacagcttcaatggcagtttaataagacatttgcaagttagtcacactttgttttat
gatgatttcatagattttaatataattgaggaagctctcatccgaagagtcttggaccgg
tcacttcttgaatatgtgaatcactcaagcaccacataa

DBGET integrated database retrieval system