KEGG   Oryctolagus cuniculus (rabbit): 100349758
Entry
100349758         CDS       T03373                                 
Symbol
TNFRSF21
Name
(RefSeq) TNF receptor superfamily member 21
  KO
K05157  tumor necrosis factor receptor superfamily member 21
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349758 (TNFRSF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349758 (TNFRSF21)
   04090 CD molecules [BR:ocu04090]
    100349758 (TNFRSF21)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100349758 (TNFRSF21)
CD molecules [BR:ocu04090]
 Proteins
  100349758 (TNFRSF21)
SSDB
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like CARD GpcrRhopsn4
Other DBs
NCBI-GeneID: 100349758
NCBI-ProteinID: XP_002714519
Ensembl: ENSOCUG00000016539
UniProt: A0A5F9D588
LinkDB
Position
12:complement(36573872..36727005)
AA seq 655 aa
MGTSASNSTTLAPCSRVAGRTRATMIAGSFLLLGFLSTTTAQPEQKAPNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMVEK
LPCAALTDRECTCPPGMFQSNGTCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVLKCKAYTDCLSQNLVVIKPGTKETDNVCGVHLSFSSTTSPSPGTAIFTSTEHMESHE
VPSSTYAPKGMNSTESNTSASVRPKVPSGIQEGTVPDNTSSASGEEGMNKTLPVLQVADH
QQGPHHRHILKLLPSMEATAGEKSSTPIKSPKRGHPRQNLHKHFDINEHLPWMIVLFLLL
VLVVIVVCSIRKSSRTLKKGPRQDPSTIVEKAGLKKSATPTQNREKWIYYCNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNTKLENSTLLMVEP
SPLDKNKGFFVDESEPLLRCDSTSSGSSALSRTGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHILNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggggacctccgcgagcaacagcaccaccctcgccccctgcagccgcgtcgccggccga
actagagccacgatgatcgcgggctcctttctcctgcttggattccttagcaccaccaca
gctcagccagaacagaaggcgccaaatctcatcggcacttaccgccatgttgaccgtgcc
actggccaggtgctaacctgtgacaagtgtccagcaggaacctacgtctctgagcattgt
accaacacaagcctgcgcgtctgcagcagttgccctgcggggacctttaccaggcatgag
aatggcattgagagatgccatgactgtagccagccatgcccatggccaatggttgagaaa
ttaccttgtgctgccttgactgaccgagaatgcacttgtccacctggcatgttccagtct
aacgggacctgcgccccccatacagtgtgtcctgtgggttggggtgtacggaagaaagga
acagagactgaggacgtccggtgtaagcagtgtgctcggggtaccttttctgatgtgcct
tctagcgtgttgaaatgcaaagcatacacagactgtctgagtcagaacttggtggtgatc
aaaccagggaccaaggagacagacaatgtctgcggagtgcacctgtccttctccagcacg
acctcaccttctcctggcacagccatcttcacaagcactgaacacatggaatcccatgaa
gttccttcctccacttatgctcccaaaggcatgaactcaacagaatccaacacttctgcc
tctgttagaccaaaggtaccaagtggcatccaggaagggacagtccctgacaatacgagc
tcagcaagtggggaggaaggcatgaataagaccctcccagtcctccaagtagcagaccac
cagcaaggcccccaccacagacacatcctgaagctgctgccatccatggaggccactgcg
ggtgagaagtccagcacacccatcaagagccccaagagaggccatcccagacagaacctg
cacaagcattttgacatcaacgaacatctgccctggatgattgtgcttttcctgctgctg
gtgcttgtggtgatagtggtatgcagcatccggaaaagctcaaggactctgaagaagggg
ccccggcaggatcccagcaccattgtagaaaaagcagggctgaagaaatctgcaactcca
acccagaaccgggagaagtggatctactactgcaatggccatggtattgacatcctgaaa
cttgtagcagcccaagtggggagccagtggaaagacatctatcagtttctatgcaatgcc
agcgagagggaagtggctgccttctccaacgggtacacagcagaccacgagcgggcctac
gccgctctgcagcactggaccatccggggccctgaggccagccttgcccagttgatcagt
gccctgcgccagcaccggcgcaacgatgttgtggagaagattcgtggcctgatggaagat
accacccagctggaaaccgacaaactggctctcccaatgagccccagcccgcttagcccg
agccccatccccagtcccaacacgaaactggagaattccactctcctgatggtggagccc
tcccccctggataagaacaagggcttctttgtggatgagtccgagccccttctgcgctgt
gactccacatccagcggctcctcagcgctgagtcggaccggctcctttattaccaaagaa
aagaaggacacagtgttgcggcaggtccgcctggacccctgtgacttgcagcctatcttt
gatgacatgctccacattctgaatcctgaggagctgcgagtgattgaagagattccccag
gctgaggacaagctggatcgactgttcgagattattggagtcaagagccaggaagccagc
cagaccctcctggactctgtttatagccatcttcctgacctattgtag

DBGET integrated database retrieval system