KEGG   Oryctolagus cuniculus (rabbit): 100349814
Entry
100349814         CDS       T03373                                 
Symbol
UBE2L6
Name
(RefSeq) ubiquitin conjugating enzyme E2 L6
  KO
K04553  ubiquitin-conjugating enzyme E2 L6 [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100349814 (UBE2L6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100349814 (UBE2L6)
   05022 Pathways of neurodegeneration - multiple diseases
    100349814 (UBE2L6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100349814 (UBE2L6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100349814 (UBE2L6)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100349814 (UBE2L6)
  UBL-conjugating enzymes
   100349814 (UBE2L6)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100349814
NCBI-ProteinID: XP_002709208
Ensembl: ENSOCUG00000021867
UniProt: G1TUN6
LinkDB
Position
1:complement(190634949..190644859)
AA seq 153 aa
MTASKRVAKELEDLQKKPPSYLRNLLSDDANVLEWHALLLPDQPPYHRKAFSLRINFPKE
YPLKPPAVTFTTKIYHPNVDENGQVCLPIISKENWKPYTKAYQVLEALYNLVNRPDLAEP
VRVELADLLTQNPELFQRKAEEFTLQFGVDRPS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgacggccagcaagcgagtggcgaaggagctggaggatcttcagaagaagcctccctcg
tacctgaggaacctgctcagcgatgatgccaatgtcctggagtggcacgcgctcctcctg
cccgaccagcctccctaccatcgcaaggccttcagtctgcgcatcaacttccccaaggag
tatccactcaagcctcccgcggtgacgttcaccaccaagatctaccaccccaatgtggat
gaaaacgggcaggtctgcctgcccatcatcagcaaagagaactggaagccttacaccaag
gcctaccaagtcttggaggccctctacaatttggtgaatagaccggatctggcggagccc
gtgcgggtagagctggctgacctgctgacccagaacccggagctgttccagaggaaggca
gaagagttcaccctccagttcggagtggaccggccctcctaa

DBGET integrated database retrieval system