KEGG   Oryctolagus cuniculus (rabbit): 100349872
Entry
100349872         CDS       T03373                                 
Symbol
TNFRSF1B
Name
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100349872 (TNFRSF1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349872 (TNFRSF1B)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100349872 (TNFRSF1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100349872 (TNFRSF1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100349872 (TNFRSF1B)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100349872 (TNFRSF1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100349872 (TNFRSF1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349872 (TNFRSF1B)
   04090 CD molecules [BR:ocu04090]
    100349872 (TNFRSF1B)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100349872 (TNFRSF1B)
CD molecules [BR:ocu04090]
 Proteins
  100349872 (TNFRSF1B)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100349872
NCBI-ProteinID: XP_017193077
Ensembl: ENSOCUG00000014127
UniProt: G1T6S8
LinkDB
Position
Un
AA seq 425 aa
MAPATLWAALAVGLQLWASGHTVPAQVTVTPSPSEPGGSCQLEEYYDSRAQRCCRKCPPG
QHVKAFCTQSSDTVCAPCEDSTYTQLWNQVAKCFSCGARCSANQVEIQACTRKQNRICTC
GPGWYCMLGRQEGCRLCAPLRKSRPGSGVAKQAVTWRPSLATPVRMQSTSVSPPPRVALG
AARTPRPASMTSQHVGPTPGPSTEPSFLLPMGPSPPTEGLRTDSISLPVGLIVGVTVLGL
LMIGLVNIVILSQKKRKLPCLQREAKAPHLPADKARSAPGLEQQHLLTTAPSSSSSSLES
SASATDRRAPTRNQPAAPGVEKAPGSGEAQASCTSPESLPGGHGTQVNVTCIVNVYSGSD
HGSPCASQASSTGEDTDTSPTVDEQVPFSQEERPLQSHLGASETLLQSPEKSLPLLVPDA
GRKPS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcgcccgccacgctctgggccgcgctggccgtcggactgcagctctgggcttccggg
cacaccgtgcccgcccaggtcacggtcacccccagcccctcagagcctggggggtcctgc
cagctagaagagtactatgactccagggcccagcggtgctgcaggaagtgtcccccgggc
caacacgtgaaagccttctgcacccagagttcagacaccgtgtgcgccccctgcgaggac
agcacgtacacgcagctgtggaaccaggtcgccaagtgcttcagctgtggtgcccgctgc
agtgccaatcaagtagaaatccaagcctgcaccaggaaacagaaccggatctgcacctgc
gggccaggctggtactgcatgctggggaggcaggaaggctgccggctgtgtgcgccactg
cgcaagtcccgccctggctccggtgttgccaagcaagctgtcacttggcggccgtccctg
gcaactccagtgcgaatgcagtctacatctgtgtccccacccccaagggtggccctgggg
gcagcccgcacgccccggccagcgtccatgacatcccaacacgtgggaccaacaccgggg
cccagcacagagccctccttcctgctcccgatgggccccagccccccgaccgaggggctc
cgcacagacagcatctctcttcccgtgggactgattgtgggtgtgacagtcttgggcctg
ctaatgataggactggtgaacattgtcatcctgtcccagaagaaaaggaagctgccctgc
ctgcagagagaagccaaggcgcctcacctgcctgccgataaggcccgcagtgcacctggc
ctcgagcagcagcacctgctgaccacggcaccaagctccagcagcagctccctggagagt
tcggccagcgccacggacaggagggcgcccaccaggaaccagccggcggcaccaggtgtg
gagaaggctcccgggtccggggaagcccaggccagctgcacgagcccagagtccttgccc
ggtggccacgggacccaggtcaatgtcacgtgcatcgtgaacgtctacagcggctctgac
cacggctcgccctgcgcctcccaggccagctccacgggggaggacacagacaccagcccc
acggtggacgagcaggtgcccttctcccaggaggagcgccccctgcagtcccacctgggg
gcctccgagactctgctgcagagccccgagaagtccctgccgctcctcgtacctgacgct
ggcaggaagcccagctaa

DBGET integrated database retrieval system