KEGG   Oryctolagus cuniculus (rabbit): 100349912
Entry
100349912         CDS       T03373                                 
Symbol
HSPD1
Name
(RefSeq) heat shock protein family D (Hsp60) member 1
  KO
K04077  chaperonin GroEL
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03018  RNA degradation
ocu04940  Type I diabetes mellitus
ocu05134  Legionellosis
ocu05152  Tuberculosis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100349912 (HSPD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100349912 (HSPD1)
   05152 Tuberculosis
    100349912 (HSPD1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100349912 (HSPD1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349912 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100349912 (HSPD1)
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100349912 (HSPD1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100349912 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349912 (HSPD1)
Messenger RNA biogenesis [BR:ocu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     100349912 (HSPD1)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   100349912 (HSPD1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    100349912 (HSPD1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349912 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   100349912 (HSPD1)
  Exosomal proteins of breast cancer cells
   100349912 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   100349912 (HSPD1)
  Exosomal proteins of bladder cancer cells
   100349912 (HSPD1)
SSDB
Motif
Pfam: Cpn60_TCP1 EAD9
Other DBs
NCBI-GeneID: 100349912
NCBI-ProteinID: XP_002712414
Ensembl: ENSOCUG00000012736
UniProt: G1T3Y8
LinkDB
Position
7:complement(137982509..137993822)
AA seq 573 aa
MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKILQSSPEIGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcttcgattacccacagtccttcgccagatgaggccagtgtccagggcactggctcct
catctcactcgggcttacgccaaagacgtaaaatttggtgcagatgcccgagctttaatg
cttcaaggtgtagaccttttagccgatgctgtagccgtgacaatggggccaaaggggaga
acagtaattattgaacagagttggggtagccctaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgacttaaaggataaatataagaatattggagctaaacttgttcaagat
gttgccaataacacaaatgaagaggctggggatggcaccaccacagctactgtgctggcc
cgctctattgccaaggaaggctttgagaagattagcaaaggtgctaatccagtggaaatc
agaagaggtgtgatgttagctgttgatgctgtaattgctgagcttaagaagcagtcaaaa
cctgtgacaacccctgaagaaattgctcaggttgctacaatttctgcaaatggagacaaa
gaaattggcaacatcatttctgatgcaatgaagaaggttggaaggaaaggtgtcatcaca
gtaaaggatgggaaaacactgaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggctatatttctccatactttattaatacatcaaaaggtcagaaatgtgaattccaa
gatgcctatgttctgctgagtgaaaagaaaatatctagtgtccaatccatcgtacctgct
cttgaaattgccaatgctcaccgtaagcccctggtcataattgctgaagatgttgatgga
gaagctctgagtacacttgttttgaataggctaaaagttggtcttcaggttgtagcagtc
aaagctccaggttttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtatttggagaagagggattgaccctaaatcttgaagatgttcaacctcat
gacttaggaaaagttggagaagtcattgtgaccaaagatgatgctatgcttttgaaagga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcatcgagcagttagacatc
acgactagtgaatatgaaaaagaaaaactgaatgaacgtcttgcaaagctttcagatgga
gtagctgtgctaaaggttggtgggacaagtgatgttgaagtaaatgaaaagaaggacaga
gttacagatgccctaaatgctacaagagctgctgttgaagaaggcattgttctgggagga
ggttgtgccctgcttcggtgcattccagccttggactcactaactccagctaatgaagat
caaaaaattggtatagaaattattaaaagaacactgaaaattccagcaatgactattgct
aagaatgcaggtgttgaaggatccttgattgttgagaaaattctgcaaagctccccagaa
attggttatgatgctatgcttggggattttgtgaatatggtagaaaaaggaatcattgat
ccaacaaaggttgtaagaactgctttactggatgctgctggagtggcctctctgttaact
acagcagaagttgtagtcacagaaattcctaaagaagagaaggaccctggaatgggcgcg
atgggcggaatgggaggtggtatgggaggtggtatgttctaa

DBGET integrated database retrieval system