KEGG   Oryctolagus cuniculus (rabbit): 100349996
Entry
100349996         CDS       T03373                                 
Symbol
CSF2RB
Name
(RefSeq) colony stimulating factor 2 receptor beta common subunit
  KO
K04738  cytokine receptor common subunit beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04210  Apoptosis
ocu04630  JAK-STAT signaling pathway
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349996 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349996 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100349996 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349996 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100349996 (CSF2RB)
   04090 CD molecules [BR:ocu04090]
    100349996 (CSF2RB)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   100349996 (CSF2RB)
CD molecules [BR:ocu04090]
 Proteins
  100349996 (CSF2RB)
SSDB
Motif
Pfam: fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind IL2RB_N1 LIFR_N Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100349996
NCBI-ProteinID: XP_008255295
UniProt: G1TK65
LinkDB
Position
4:complement(84975663..85000132)
AA seq 868 aa
MALTPGLLLVTLLALRWGPGIARAETVPLQTLRCYNDYTSHVVCSWADTEEAGRLINVTL
HRRVAPAPQQPVSCELTDDMPWSQCPSARCVPRRCVIPYQNFVLADNDTFSFQPDRPLGA
QLTVTLAQHVQPPPPTDLQISSRGGGFLLSWSVDLGESQRPWLSREDLEFEVLFRRLHDS
WEEATSLLSNSSQAILGPEHLTPNSPYVARVRTRLAPGVAFSGRPSEWSSEIQWDSQSGD
KAQPQHLQCFFNGAHALSCSWEVKSQVTSSVSFGLFYKSGPDAREEECSPVLKEELRGRY
TRHRCRVPVPDPRTHGQYTLSVRPRREEKFIKSSDNIQMARPSLNVTKDGDSYSLRWEAG
KMYYRHIDHTFQVQYRKDTVAWEDSRSETLDNAHSMALPSLEPSTKYRARVRVRPKSGVY
NGIWSEWSEERSWTTERVLPVWVLALSLVFLTLALILGLRFCGTYGYRLNQKWQENIPSP
GKSHLFQDGGAGLRLPDSTWAFPSKGTLHQGSGGSRGPEPVGDSEVSPLSIEDPTEVLEA
QPGPAAMPADPSLPATPPSTPPLGSAATVGSPVSQASSFDFNGPYLGSPQSRSLPDVRGQ
LAKPQTDAGQEASLPGSLEYLCLPPGGQVQLVPLAQVTGQGRAKAEQQRPSQGAPGSPSL
EPGGGPVPPTRAQGEGGQDPKDNPGALHMGSGYISTTDLALTLPTAALALSLPPPSDQHP
SLCPGLAEEPPGASAPGKPEFEGYVELPPTTGLHPKSPQASSHVLSPTEPWGDVAPASPH
SKGLLVLQQVGDYCFFPDLGPGPPSLRSKPSSPGLCPETGDPEQVLGDKKPLCPPVPQVP
VIQLFKALKQQDYMSLPPWEVGRSRQVC
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcgctgactccaggtctgctcctcgtgaccctgctggctcttcgctggggccccggt
atcgcaagggcagagaccgtcccactgcagaccctgcgctgctacaatgactacaccagc
cacgtggtctgcagctgggcagacactgaggaggcgggccggctgatcaacgtgaccctc
caccgccgcgtggccccggccccccagcagccggtgtcctgcgagctcactgatgacatg
ccctggtcacagtgcccctctgcccgctgcgtgccccggagatgcgtcatcccctaccag
aacttcgtcctcgccgacaacgacaccttctcattccaaccagacaggcctctgggcgcc
cagctcacggtcactctggcccagcacgtccagccgcccccacccacggacctgcagatc
agcagcagggggggcggcttcctgctgagctggagcgtggaccttggcgagtcccagagg
ccctggctgtcccgggaggacctggagttcgaggtgctcttcaggcggctgcacgactcc
tgggaggaagccacctccctcctgtccaactcctcccaggccatcctgggcccagagcac
ctcactcccaacagcccctacgtggctcgggtgcggacccggctggccccaggggtggct
ttctcagggcggcccagcgagtggagctcggagatccagtgggactcgcagtcaggggac
aaggcccagccccagcacctgcagtgcttcttcaatggggcccacgcgctcagctgctcc
tgggaggtgaagtcccaggtgaccagctccgtgtccttcggcctcttctacaagtccggc
ccggacgcgagggaggaagaatgttccccagtgctgaaggaggagctgcgcggccgctac
acccggcaccgctgccgcgtgcccgtgcccgacccccgcacccacggccagtacaccctc
tctgttcggccgaggagggaagagaaatttataaagagctcagacaacatccagatggcc
cgccccagcctcaacgtcaccaaggatggagacagctacagcctgcgctgggaggcgggg
aagatgtactacagacacatcgaccacaccttccaggtccagtacaggaaggacacggtc
gcctgggaggacagcaggtcagagaccctggacaatgcgcacagcatggccctgccatct
ctggagccctccaccaagtaccgggccagggtgcgggtccggcccaagtcaggcgtctac
aacgggatctggagcgagtggagtgaggagcgctcctggaccacagagcgggtgctgcct
gtgtgggtgctggcgctcagtctggtcttcctcaccttggccttgatcctgggtctgcgc
ttctgcggcacctatgggtacaggctgaaccagaagtggcaggagaacatccccagcccc
ggcaagagccacctgttccaggatggcggcgcagggctgcggctcccagacagcacgtgg
gctttccctagcaagggcaccctgcaccagggatccgggggcagccgtggtcctgagcca
gtgggggacagcgaagtgtccccgctgagcatagaggaccccacagaggtcctagaggca
cagccggggcctgcagcgatgcccgccgacccgagtctgcccgcgacaccgccctccacg
cccccgctgggctccgcggccaccgtaggcagccccgttagccaggcttccagcttcgac
ttcaacggcccctacctggggtccccccaaagccgctccctgcctgacgtccggggccag
ctggcgaagccacagacggatgcggggcaggaggcgtccctgccgggctcgctggaatac
ctgtgtctgcctccgggcgggcaggtgcagctggtcccgctggcccaggtgacggggcag
ggccgggccaaggccgagcagcagaggcccagccagggggccccagggagcccctccctg
gagcctggtggaggtcctgtccccccgacacgggcccagggcgaaggtggccaggacccc
aaggacaacccaggggctctgcacatgggctccggttacatctccaccaccgacctggcg
ctcaccctgcccacagcagccctggcactctcgctgcctcctccctcagaccagcacccc
agcctctgccctgggctggccgaagagccccctggagcctcagcccctgggaagccagag
tttgagggctatgtggagctccctcccaccacaggcctgcaccccaagtcccctcaagcc
agcagccatgtcctgagccccacggagccctggggggatgtggccccagcatccccccac
tccaaggggctccttgtcctccagcaggtgggtgactactgcttcttccctgacctggga
cccgggcctccctcactgcggagtaaaccctcttccccgggactctgtcctgagactggg
gaccccgagcaggtgttgggggacaagaagcccctgtgcccgcccgtgccgcaggtgccg
gtcattcagctcttcaaggccctgaagcagcaagactacatgtcactgcccccctgggag
gtgggcaggtccaggcaggtgtgctga

DBGET integrated database retrieval system