KEGG   Oryctolagus cuniculus (rabbit): 100350053
Entry
100350053         CDS       T03373                                 
Symbol
VHL
Name
(RefSeq) von Hippel-Lindau tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350053 (VHL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100350053 (VHL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100350053 (VHL)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100350053 (VHL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350053 (VHL)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Target recognizing subunit
     100350053 (VHL)
SSDB
Motif
Pfam: VHL VHL_C
Other DBs
NCBI-GeneID: 100350053
NCBI-ProteinID: XP_008248208
LinkDB
Position
Un
AA seq 247 aa
MTKEELGCICARARFKRCLPGPPTERAGLPGSACACVHARLPPRGGSASPGAPRPGLSVR
DAIPRKRPRPGAEKAALASAGMAAERPLPVLRSVNTREPSQVIFCNRSPRVALPVWLNFH
GEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANIT
LPVYTLKERCLQVIRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLARLTQEHFENQQLE
EETENHS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgacgaaggaggagctggggtgcatctgcgcacgcgcacgcttcaagcgttgcctcccc
ggtccccccaccgagcgcgccggcctgcccgggagcgcgtgcgcatgcgtacacgcgcgc
ctccctccccgcggcgggtctgcgagccccggcgcgcccaggcccgggctgtccgtgcga
gacgcgattccccggaagaggccgagacccggcgcggagaaggcggcgctcgccagtgcg
gggatggcggccgagcggccgctgcccgtgctgcgctcggtgaacacgcgcgagccgtcc
caggtcatcttctgcaaccgcagcccgcgcgtcgcgctgcccgtgtggctcaacttccac
ggagagccgcagccctaccccacgctgccgccgggcacgggccgccgcatccacagctac
cgaggtcacctgtggctcttcagagatgcagggacacacgatgggcttctggttaaccaa
acggagttgtttgtgccatctctcaatgttgatgggcagcctatttttgccaacatcaca
ctgccagtgtacacgctcaaagaacgatgcctccaggttatccgaagcctggtcaagcca
gagaactacaggaggctggacatcgtccggtcactctacgaagatctggaggaccacccg
aacgtgcagaaagacctggcgcggctgacgcaggagcactttgaaaatcagcagttggaa
gaggagactgaaaaccacagctga

DBGET integrated database retrieval system