Oryctolagus cuniculus (rabbit): 100350107 Help Entry 100350107         CDS       T03373                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04020   Calcium signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04070   Phosphatidylinositol signaling system ocu04114   Oocyte meiosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04371   Apelin signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04728   Dopaminergic synapse ocu04740   Olfactory transduction ocu04744   Phototransduction ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04921   Oxytocin signaling pathway ocu04922   Glucagon signaling pathway ocu04924   Renin secretion ocu04925   Aldosterone synthesis and secretion ocu04970   Salivary secretion ocu04971   Gastric acid secretion ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05031   Amphetamine addiction ocu05034   Alcoholism ocu05133   Pertussis ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05214   Glioma ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100350107    04015 Rap1 signaling pathway     100350107    04371 Apelin signaling pathway     100350107    04020 Calcium signaling pathway     100350107    04070 Phosphatidylinositol signaling system     100350107    04024 cAMP signaling pathway     100350107    04022 cGMP-PKG signaling pathway     100350107  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100350107    04218 Cellular senescence     100350107  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100350107   09152 Endocrine system    04910 Insulin signaling pathway     100350107    04922 Glucagon signaling pathway     100350107    04912 GnRH signaling pathway     100350107    04915 Estrogen signaling pathway     100350107    04921 Oxytocin signaling pathway     100350107    04916 Melanogenesis     100350107    04924 Renin secretion     100350107    04925 Aldosterone synthesis and secretion     100350107   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100350107    04270 Vascular smooth muscle contraction     100350107   09154 Digestive system    04970 Salivary secretion     100350107    04971 Gastric acid secretion     100350107   09156 Nervous system    04728 Dopaminergic synapse     100350107    04720 Long-term potentiation     100350107    04722 Neurotrophin signaling pathway     100350107   09157 Sensory system    04744 Phototransduction     100350107    04740 Olfactory transduction     100350107    04750 Inflammatory mediator regulation of TRP channels     100350107   09159 Environmental adaptation    04713 Circadian entrainment     100350107  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100350107   09162 Cancer: specific types    05214 Glioma     100350107   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100350107    05163 Human cytomegalovirus infection     100350107    05167 Kaposi sarcoma-associated herpesvirus infection     100350107   09171 Infectious disease: bacterial    05133 Pertussis     100350107    05152 Tuberculosis     100350107   09164 Neurodegenerative disease    05010 Alzheimer disease     100350107    05012 Parkinson disease     100350107    05022 Pathways of neurodegeneration - multiple diseases     100350107   09165 Substance dependence    05031 Amphetamine addiction     100350107    05034 Alcoholism     100350107   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100350107    05418 Fluid shear stress and atherosclerosis     100350107  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     100350107   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100350107    03036 Chromosome and associated proteins [BR:ocu03036]     100350107   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100350107 Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100350107 Membrane trafficking [BR:ocu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100350107 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100350107 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100350107 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH EF_EFCAB10_C Allatotropin-like_C SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen EF-hand_EFHB_C Dockerin_1 DUF1103 FCaBP_EF-hand DUF5580_M BamM_C Motif Other DBs NCBI-GeneID:  100350107 NCBI-ProteinID:  XP_051682112 Ensembl:  ENSOCUG00000011659 LinkDB All DBs Position 20:complement(14860148..14869980) Genome browser AA seq 341 aa AA seqDB search MLRWEGSHRKGGAGAAGRTLPTPGAATSSRSGHVRGSGWSSRGGESPQDPAPPPPAAFPG PGAGWARRGARAGGGGRPGGPGGGAGARGPAAAAPPCARRAPPRRRDTACLIYIRRGAGS RSGSGAGRLVDAAPLLAVGRRRRRRRRHSAERTRLLSGGGGGSSSGRPPRRHSPCAGAAS LAPSDRAPFARAMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAE LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRH VMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt atgctgaggtgggaggggtcgcacaggaagggtggggcaggggccgcggggcgcacgctt ccgactcccggagccgccacctcctccaggtccggccatgtgaggggctcggggtggtcc agccgcggaggcgagtcccctcaggaccccgcgcccccgccccccgccgccttcccgggc ccgggcgcgggctgggcccgccgcggagcgcgcgcagggggcggcgggaggccgggcggg cctgggggcggggccggcgcgcgaggcccggccgccgcagcgccgccgtgcgccaggcgg gccccgccgcggcggagggatacggcgtgccttatatatatacggcggggcgccggctcg cgctccggcagtggcgctgggaggctcgtggacgcggcgccgttactcgcagtcgggcgg cggcgcaggcggcggcggcggcacagcgcggagcgcactcggctcctcagcggcggcggc ggcggcagcagcagcgggaggccccctcgccgtcacagcccctgcgcgggtgcagccagc ctcgctccctccgatcgcgctcccttcgcccgcgccatggctgatcaactgaccgaagaa cagattgctgaattcaaggaggctttctccttattcgataaagatggtgatggcaccatc acaacgaaggaacttggaactgtcatgcggtcactgggtcagaacccgacagaggcggag ctgcaggacatgatcaacgaagtggacgctgacggtaatggcaccattgacttcccagaa tttctgactatgatggctaggaaaatgaaggacacagatagtgaagaggagatccgtgaa gcattccgagtctttgacaaggatggaaacggctatatcagtgcggcggaactgcgccac gtcatgacaaacttgggggaaaagctcacagatgaagaagtagatgaaatgatcagagaa gcagatatcgacggagacggacaagtcaactacgaagaattcgtacagatgatgaccgca aaatga

DBGET integrated database retrieval system