KEGG   Oryctolagus cuniculus (rabbit): 100350229
Entry
100350229         CDS       T03373                                 
Symbol
ANAPC4
Name
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350229 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100350229 (ANAPC4)
   04114 Oocyte meiosis
    100350229 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100350229 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350229 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350229 (ANAPC4)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350229 (ANAPC4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100350229 (ANAPC4)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100350229 (ANAPC4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100350229
NCBI-ProteinID: XP_008272966
Ensembl: ENSOCUG00000016004
UniProt: G1TAQ4
LinkDB
Position
2:15899405..15945571
AA seq 809 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKVVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSAGGAAEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDATGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVEKVGQYL
KDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQK
PADVIGKSMNQAICIPLYRDARSEDCARRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMC
ILRRHTDISQSVSNGLIAVKFGSFTYATTEKIRRSTYSCLDAQFYDDETVTVVLKDTVGR
EGRDRLLVQLPLSLVYNSEDSAEYQFTGSYSVRLDEQCGVIPTRTVHFEKHWRLLESMKA
QYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDDEEEAGSKPVRIKEEVLSEA
EAESQQAGAAALAPDVVIKVEELDPELDA
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgttgcgctttccgacctgtttcccatccttccgggtggtgggagagaagcagctgccg
caggagatcattttcctggtctggtcgcccaagcgggacctcattgctttggccaacaca
gcgggcgaggttttgcttcaccgacttgcaagttttcatcgagtttggagttttccacca
aatgaaaacacaggaaaggaagtgacctgtctggcttggagaccagatggcaaacttttg
gcctttgctcttgctgacaccaagaaagttgttttgtgtgatgtagagaaacctgagagc
ttgcactctttttctgtggaggctcctgtttcttgcatgcattggatggaagtgactgtg
gaaagcagtgttctgacatctttttataatgctgaagatgagtcaaatcttctgttacct
aaactgcctacattgccaaaaaactacagcaacacctcaaaaatatttagtgaagaaaat
tccgatgaaattattaagctcttgggagatgtcaggcttaatattcttgtccttggagga
agctctggctttattgaactgtatgcttatggcatgttcaagatcgcccgagtcacgggg
attgctggcacctgtctcgcgttgtgtttgtccagtgatctgaagtcactatcagtggtc
acagaggtgtctgccggtggggctgcagaggtctcttacttccagcttgaaaccaacctg
ttatactctttcttacctgaagtaactcgcatggccagaaagtttacacacatttcagct
cttttacagtatataaatttgtcgctgacgtgtatgtgtgaagcatgggaagagatcctc
atgcagatggattctcgtctcactaagtttgtgcaggaaaagaacacgaccacatcagtg
caggatgaattcatgcacctgctgctgtgggggaaagcaagtgctgaactgcagactctc
ttaatgaaccagttaacagtaaagggcttaaaaaagcttggccagtctatcgaatcatca
tattccagtatacaaaagttggttataagtcacttacagagtggctctgagtctttgctg
taccatttgagtgagttgaaaggaatggcttcgtggaaacaaaaatacgagcccctggga
ctggatgccacaggcatcgaagatgctattaccgctgtgggttccttcatactcaaggcc
aatgaacttcttcaagttatcgatagtagtatgaaaaacttcaaagcattttttcggtgg
ctgtatgtagcaatgctgagaatgacagaagaccacgtgcttcccgagctgaataaggtg
atgactcaaaaagatattacatttgttgctgaatttcttactgaacatttcaatgaggct
cctgacctttataatcgcaaaggaaaatactttaacgttgaaaaagttggtcagtacctg
aaagacgaagatgacgatctcgtgtcgccccctaacacggaaggaaaccagtggtatgac
tttcttcaaaacagcagccaccttaaagaaagtcctttgctgtttccttattaccctcga
aaatcattgcattttgtgaaaaggcgcatggagaacatcattgaccagtgtttgcaaaag
ccagctgacgtaattggaaaatcaatgaatcaagccatctgcatcccattatacagagat
gctaggagtgaggattgtgctcgtagattgttcaaattcccttttctgtggaataataaa
acttcaaatctgcattatcttctttttactattttagaagattcactttataaaatgtgc
atcttaaggagacatactgatatttcccaatctgtaagtaatggactgattgctgttaag
tttgggagcttcacgtatgccacaactgaaaaaatcaggagaagcacctacagctgttta
gatgcgcagttttatgatgatgaaactgttacggtggttcttaaagacacagtaggacgg
gagggaagagacagactcttggtccagctgccattgtctttagtatacaacagcgaagat
tctgccgaataccagttcactgggagttactctgtaaggctggacgagcagtgcggcgtc
atccccacgcgcactgtgcatttcgagaagcactggcggttactggaaagcatgaaagca
cagtacgtcgctgggaatggtttccggaaagtgtcctgcgtgttaagctcgaacctgcgc
cacgtgagagtgtttgaaatggacatcgatgacgagtgggagctggatgagtcttcggac
gacgaggaggaggcgggcagcaagcctgtgaggataaaggaggaggtgctgtctgaggcc
gaggccgagagccagcaggctggcgccgccgcgctggctcccgacgtcgtcatcaaagtg
gaagagctggaccccgagctggacgcgtag

DBGET integrated database retrieval system