KEGG   Oryctolagus cuniculus (rabbit): 100350283
Entry
100350283         CDS       T03373                                 

Symbol
TBX21
Name
(RefSeq) T-box 21
  KO
K10166  T-box protein 21
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100350283 (TBX21)
   04659 Th17 cell differentiation
    100350283 (TBX21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100350283 (TBX21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100350283 (TBX21)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Other transcription factors
   T-box
    100350283 (TBX21)
SSDB
Motif
Pfam: T-box T-box_assoc
Other DBs
NCBI-GeneID: 100350283
NCBI-ProteinID: XP_008269595
Ensembl: ENSOCUG00000012907
LinkDB
Position
19
AA seq 531 aa
MGIVEPGCGEMLMGTEPMPASDEGRAPGADPQHRYFYPEPGAHDPSDRRGGRQLGAXYAG
GALVPGPARPLLGGLRLPPRPQAAGFPGTAEPYPPPAGAEGYQPGDGYAAPDPRASLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSVSGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVTDGEPEAACHAANTHVFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDTSVPSPPAPNCQVPGGDPYSPLLP
SQYPVPGRFYPELPGQAKEVVPQPYWLGPPRDHSYDAEFRAVSMKPAFLPSAPGPTVPYY
RGQEVLAPAAGWPVAPQYPPKMGTASWFRPMRTLPMEPGPRASEDQVSASLWTDITPLRP
ESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEVAEGQFYNYFPN
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgggcatcgtggagccgggctgcggagagatgctgatgggcaccgagccgatgccggcg
agcgacgagggccgggcgcctggcgccgacccgcagcaccgctacttctatcctgagccc
ggcgcgcatgacccgtccgaccggcgcggggggcggcagctcggggcgntctacgcaggg
ggcgccctggtgcccggccccgccagaccgcttctcggaggcctacgcctcccgccccgg
ccccaggcggccggctttcctgggacggccgagccctatcctccgccggcgggcgccgag
ggctaccagcccggggatggctacgcagccccggacccgcgcgccagtctctacccgggg
ccgcgcgaggactatgcgctgcccgctgggctggaggtgtcgggaaagctgagagtggcg
ctcaacaaccacctgttgtggtccaagttcaatcagcaccagacggagatgatcatcacc
aagcaggggcggaggatgttcccgttcctgtcgttcaccgtggcggggctggagcccacc
agccactacaggatgttcgtggacgtggtcttggtggaccagcaccactggcggtaccag
agcggcaagtgggtgcagtgtggaaaagccgaaggcagcgtgtcaggaaaccgcctgtac
gtccatccagattcacccaacaccggagcccactggatgcgccaggaagtttcatttggg
aaactgaagctcacgaacaataaaggggcctccaacaacgtgacccagatgatcgtgctg
cagtccctccataagtaccagccccggctgcacatcgtggaggtgacggacggagagccg
gaggcagcgtgccacgccgccaacacgcacgtcttcaccttccaagagacgcagttcatc
gccgtgaccgcctaccagaacgccgagatcacgcagctgaagattgacaacaaccccttt
gccaaaggcttccgggagaactttgagtccatgtatgcatctgtggacaccagcgtcccc
tccccgcctgcacccaactgtcaggtgcctggtggagacccctactcgcctctcctcccc
agccagtaccccgttcccggccgtttctaccccgagcttcctggccaggccaaggaggtg
gttccgcagccttactggctggggcccccccgggaccacagctacgacgccgagtttcga
gcggtcagcatgaagcccgcattcctgccctccgcccctgggcccaccgtgccctactac
cgcggccaggaggtcctggcgcctgcagccggctggccggtggccccccagtacccaccc
aagatgggcacagccagctggttccgccccatgcggactctgcccatggaacctggcccc
agagcctcggaggaccaggtctccgcctcgctctggactgacatcacgcccctccggccg
gagtccagtgactcagggctgggcgaaggggactctaagaggagacgcgtgtccccctat
ccttccagtggcgacagctcctcccccgccggggccccgtccccttttgataaggaggtc
gcggagggccagttttataactatttccccaactga

DBGET integrated database retrieval system