KEGG   Oryctolagus cuniculus (rabbit): 100350286
Entry
100350286         CDS       T03373                                 
Symbol
ANAPC5
Name
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04657  IL-17 signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350286 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100350286 (ANAPC5)
   04114 Oocyte meiosis
    100350286 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100350286 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100350286 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350286 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350286 (ANAPC5)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350286 (ANAPC5)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100350286 (ANAPC5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100350286 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_2 TPR_10 TPR_7 MapZ_EC1
Other DBs
NCBI-GeneID: 100350286
NCBI-ProteinID: XP_002719785
Ensembl: ENSOCUG00000002722
UniProt: G1SI60
LinkDB
Position
21:6242963..6286116
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEDSCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQSGEKKTVEDADMELTGR
EDGERKMEKEDLDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESVHSGVQQNNTESFAVALCHLAELHAEQ
GCFAAAAEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
MEGVYRKAVVLQAQNQMSEAHKLLQKLLSHCEKLKNTEMVISVLLSVAELYWRSSCPTIA
MPVLLHALALSKEYRLQYLASETVLNLAFAQLILGIPEQALTLLHMAIEPVLADGAILDK
GRAMFLVAKCQVASAASCDPPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVLYFQARL
YHMLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagcgtccacgaaagcctctacttcaatccaatgatgaccaacggggtggtgcac
gcgaacgtgttcggcatcaaggactgggtgacgccatataagatcgccgtgctggtgctg
ttgaacgagatggggcgcacgggcgagggcgccgtgagcctcatggagcggcggaggctc
aaccagctgctcctgccgctgctgcagggcccagatatcacgctgtcaaaactgtacaag
ttgattgaagactcttgtcctcagctggcaaattcagtacagatcagaatcaaactgatg
gctgaaggcgaattgaaggatatggagcaattttttgatgacctttcagattctttttct
ggaactgagccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatgatc
ctggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcaacag
tatttccaaagtggtgagaaaaaaaccgtggaggatgctgatatggaactgaccggtaga
gaagacggagaaagaaaaatggaaaaagaagacctggacgtctctgtgagagaagaggaa
gtatcttgcagtgggcctctatcccaaaagcaagcagagttttttctttctcagcaggct
tctttattaaagaatgatgaaactaaagcccttactccagcttccctgcagaaggaattg
aacaacttgttgaaatttaatccggattttgctgaagcgcactacctcagctacttgaac
aacctccgcgtccaggatgttttcagttcgacacacagcctgctgcattattttgaccgc
ctgatactcactggagccgagggcaaaagcaacggggaagagggctacgggcggagcctg
cgatacgccgccctgaacctggctgccctccactgccgcttcggtcactatcaacaggca
gagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgtctc
cagcactgtttgagctggctttatgtgctggggcagaagagagccgatagctatgtcctg
ctggagcactcggtgaagaaagcagtgcattttgggttaccgtacctcgcctccctggga
atacagtcccttgttcaacagagagcttttgctgggaagacggccaacaagctgatggac
gccctcaaggactccgacctcctgcactggaagcacagcctgtcggagctcatcgacatc
agcatagcccagaaaacggccatctggaggctgtacgggcgcagcaccatggcgctgcag
caagcccagatgttgctgagcatgaacagcctggagtcggtgcattcgggcgtgcagcag
aacaacacagagtcgtttgccgtcgcactctgccaccttgcagagctacacgcggagcag
ggctgttttgctgcagctgctgaagtgttgaagcacctgaaggagcgatttccgcccaac
agtcagcacgcccagttatggatgctgtgtgatcagaaaatacagtttgacagagcgatg
aatgatggcaaataccatttggctgattcactagttacaggaatcacagctcttaacagc
atggagggtgtgtatagaaaagcagttgtactacaggctcagaaccagatgtcagaggca
cacaagcttttacaaaaattgctgagtcattgtgagaaactgaagaacacagaaatggtg
attagcgtcctgctgtcggtggcagagctgtactggcgatcttcctgccctaccatcgcg
atgcccgtgctcctgcacgctctggccctctccaaggagtaccgcttacagtacttggcc
tcggaaacggtgctgaacttggcttttgcccagctcatcctcggaatcccggaacaggcc
ttaaccctcctgcacatggccatcgagcccgtcctggcggacggggccatcctggacaaa
ggccgcgccatgttcctcgtggccaagtgccaggtggcttcagcagcttcctgtgatccc
ccgaagaaagccgaagctctggaggctgccatcgagaacctcaatgaagccaagaactac
tttgcaaaggtcgactgcaaagagcgcatccgagacgtcctttacttccaggccaggctc
taccacatgctggggaagacgcaggagaggaaccggtgcgcgatgctcttccggcagctg
catcaggagctgccctctcacggcgtgcccttgatcaaccacctctag

DBGET integrated database retrieval system