KEGG   Oryctolagus cuniculus (rabbit): 100350316
Entry
100350316         CDS       T03373                                 
Symbol
UBE2J2
Name
(RefSeq) ubiquitin conjugating enzyme E2 J2
  KO
K04554  ubiquitin-conjugating enzyme E2 J2 [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100350316 (UBE2J2)
   04120 Ubiquitin mediated proteolysis
    100350316 (UBE2J2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100350316 (UBE2J2)
   05022 Pathways of neurodegeneration - multiple diseases
    100350316 (UBE2J2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350316 (UBE2J2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100350316 (UBE2J2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100350316 (UBE2J2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100350316
NCBI-ProteinID: XP_008252011
Ensembl: ENSOCUG00000000966
LinkDB
Position
Un
AA seq 259 aa
MSSNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSVETSDFTKRQLAVQSLAFNLRDKVFCELFPDVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGEVHHGQNGVPLLNGHAPGAGPNLAGLQQAHRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcagcaacagcaacaagagagccccgaccaccgcgacgcagaggctgaagcaggac
tacctgcgcatcaagaaagacccggtgccttacatctgcgccgagcccctgccttccaac
atcctggagtggcactatgtcgtccgaggccctgagatgaccccttatgaaggtggctat
tatcatggaaaactaattttccctagagaatttccttttaaacctcctagtatttacatg
ataactcccaatggaaggttcaagtgcaacacgaggctgtgtctctccatcacggacttc
caccctgacacgtggaacccagcctggtccgtgtccaccatcctgactgggctcctgagc
ttcatggtggagaaaggccccaccctgggcagcgtggagacctcggacttcacgaagagg
cagctggcagtgcagagcctagcgtttaacctgagagataaggtcttctgcgagttgttt
cctgatgtcgtggaggaaatcaaacagaagcagaaagcacaagacgaactcagtagcagg
ccccagacgctccccttaccagacgtggttccagacggggaggtgcaccatggccagaac
ggggttccgcttctcaacgggcacgcaccgggggccggccccaaccttgcggggctgcag
caagcccatcggcaccatggactcctgggcggcgccctggcgaacttgtttgtcatagtt
gggtttgcagccttcgcctacacggtcaagtacgtgctgaggagcatagcacaggagtga

DBGET integrated database retrieval system