KEGG   Oryctolagus cuniculus (rabbit): 100350416
Entry
100350416         CDS       T03373                                 
Symbol
IL12RB2
Name
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100350416 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350416 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100350416 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100350416 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100350416 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100350416 (IL12RB2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100350416 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig Pur_ac_phosph_N IL6Ra-bind UPF0560
Other DBs
NCBI-GeneID: 100350416
NCBI-ProteinID: XP_008263302
Ensembl: ENSOCUG00000008934
LinkDB
Position
13:complement(98857840..98954014)
AA seq 861 aa
MAIRRCSLVLVFITLWLSTKAKIDVCKRGDVTVKPSHVISLGSAVNISCSLKPKQGCWHY
SSFNRLILYEFNRTISFHHGGSLSTQVTDLPLGTTLFVCKLACINSNEIRICGAEISVGV
VPEQPQDLSCIQKGEHGTVACTWDRGRDTHLYTKYTLELNGPKTLSWQKQCSDQYCDHLD
FGFNLTPDLRESIFTATVIAVNVLGNSSLESVFTFLDIVRPLPPWDIRVTFLNASSSRCT
LQWRDEEWVLLNRLRYRPSRSRSWKMVNVTNARGRHDLLDLKPFTEYEFQVSSKLHLHKG
GWSDWSESLKTQTPEEEPVGTLDVWYIKQHVDYNRQHISLFWKNLSISEARGKILHYRVT
LWEMAGRKTTLQNLTRHTSWTWVVPRTGYWAAAVSAANSKGSSLPTSINITDLCGAALLA
PRQVSANPEGTDSILVSWQPPEKAGSAVREYVVEWRQLLLEGDARPRPNWLRLPLHSVSA
VLSENIKPYVCYEIHVHALSAGQGGCSSILGNSKHKAPLRGPHISDVTEDKGSVWISWDH
FPAQEQVGCILHYRIYWKEQDSHSQAQLCEIPYRVSQNSHPINSLKPRVTYVLWMTALTA
AGESPPGSERGFFLQGKANWSVFVAPSICTAVIIVGIFSMRHFRQKVCVLLSALRPQWCR
KEIPDPANSTWAKKYPIVEEQAQLLVERLQTPWSCPEEPEPLAISEVSQQGTAILGQPHR
PTCSESGQGHRSSEQDTAALSACSPPPPGTLLAEKRQAVDLYKVLGIRGQGPMLGSPASP
LPVLPVDYLPTQEGYLSSNIDDPPPGRGPPPEPAEDLAPLHVSFSVFSNSLHPLPFSCGE
KLTLAHLKMGCDASRALSGET
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggccattagaagatgctcattggtacttgtttttataaccttgtggctgtcaactaaa
gcaaaaatagatgtgtgcaagagaggagatgtgactgtgaaaccttcccatgtaatttca
cttggatcagctgtcaatatttcgtgctctctgaaacccaaacaaggctgctggcactac
tccagttttaaccggttaatcctctatgagttcaacagaacaatcagttttcaccatggt
ggctccctcagtactcaagtcacagatcttccccttgggacaaccttgtttgtctgcaaa
ctggcctgcatcaatagcaatgagattcgaatttgtggggcagagatctcggttggtgtt
gttccagaacagcctcaagacttatcttgcatacagaagggagagcatgggactgtggcc
tgcacctgggacagaggacgagacacccacctatatactaagtacactctagagttaaat
ggaccaaaaactttgagttggcagaagcagtgcagtgatcagtattgtgatcatttggac
tttggattcaacctaacccctgatttacgtgaatccattttcacagctacagttattgca
gtgaatgttcttggaaattcttcacttgagtctgtgttcactttcttggacatagtgagg
cctcttcctccgtgggacatcagagtcacatttctaaatgcttccagcagcagatgtacc
cttcagtggagagatgaggagtgggtgctgcttaatcgactcagataccggcccagccgc
agcaggtcctggaagatggttaatgtcacaaatgccagaggaagacatgatttgctggat
ctgaagccgttcacagaatatgaattccaggtttcttctaagctacatcttcataaagga
ggctggagtgattggagtgaatcattgaaaacacaaacaccagaagaagagcctgttgga
acattagatgtctggtacataaagcagcatgtggactacaacagacaacacatttctctt
ttctggaagaatctgagtatatcagaggcaagagggaaaatcctccactatcgagtgacc
ttgtgggagatggcaggaaggaaaactacactacagaacctcacaagacacacctcctgg
acctgggtcgttcccagaactggatattgggctgcagctgtgtctgcagccaactcaaaa
ggcagttccctgccaactagtattaacataacagacctgtgcggggcagcattgctggct
cctcgccaggtctctgccaacccagagggcacagacagcatcctggtgagttggcagcct
ccggagaaagctggctctgccgttcgggagtatgtggtggaatggaggcagctgcttctg
gagggcgacgcgcggccccgtccgaactggctgcggctcccgctgcacagtgtgtctgct
gtgctgtcagagaacatcaaaccctacgtgtgttatgaaatccacgtgcatgcgctgtca
gcaggccaaggaggatgcagctccatcctgggaaactccaagcacaaagctccgctgagg
ggaccccatatcagtgacgttacagaagacaagggaagtgtttggatttcatgggaccac
tttccagcccaggagcaagtgggctgcatcctccattacaggatatactggaaggaacag
gactcccattcccaggctcagctctgtgaaattccctatagagtctcccagaattcacat
ccaataaacagcctgaagcccagagtgacatatgtcctatggatgacggctctgacagct
gctggtgaaagccccccaggaagtgagaggggattttttctgcaaggcaaagccaactgg
agcgtgtttgtggcaccaagcatttgcaccgctgtcatcatagtgggcattttctcaatg
cgtcacttccggcaaaaggtgtgtgttctcctttcagccctcagacctcaatggtgtcgc
aaagaaattccagatccagcaaatagcacgtgggccaagaagtatcccattgtggaggag
caggcgcagctgctggtggagaggctccagacaccctggtcctgtcctgaagagcccgag
cccctggccatcagcgaagtctctcagcaggggaccgccatcttgggacagccccatcgc
cccacgtgctcagaaagcggccaaggtcaccgtagctcggagcaagacacagcagcgctc
agtgcctgcagcccgccaccccccggaactctcctggccgagaagagacaggcagtggac
ctgtacaaggtgctgggcatcaggggccagggcccaatgctggggagcccagccagcccc
ttgccagtcctcccggtggactacctccccacccaggagggctacttgtcctccaacata
gatgacccccctccagggagaggccctccccctgagcctgcggaagatctggcgcctctg
cacgtctctttttctgtgttttcaaactcccttcacccgctccccttctcctgtggtgag
aagctgaccctggctcacttgaagatgggctgtgacgcctctcgggctctgagtggtgag
acttga

DBGET integrated database retrieval system