KEGG   Oryctolagus cuniculus (rabbit): 100350518
Entry
100350518         CDS       T03373                                 
Symbol
BMPR1A
Name
(RefSeq) bone morphogenetic protein receptor type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100350518 (BMPR1A)
   04390 Hippo signaling pathway
    100350518 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350518 (BMPR1A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100350518 (BMPR1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100350518 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100350518 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100350518 (BMPR1A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100350518 (BMPR1A)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100350518 (BMPR1A)
CD molecules [BR:ocu04090]
 Proteins
  100350518 (BMPR1A)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase APH
Other DBs
NCBI-GeneID: 100350518
NCBI-ProteinID: XP_017204172
Ensembl: ENSOCUG00000016925
UniProt: G1TCM6
LinkDB
Position
18:8553741..8622305
AA seq 532 aa
MTQLCVHIRLLGAYLFIISRVHGQNLDSMLHGTGVKSESDQKKSENGATLAPEDTLPFLK
CYCSGHCPDDAVNNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTHLCNQYLQPTLPPAVVGPFFDGSVRWLVVLVSMAICIVAMIIFSSCFCYKHYC
KSMSSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCVTGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgactcagctctgtgtgcacatcaggttactgggagcctatctgttcatcatttctcgt
gttcacggacagaatctagacagtatgctccatggcactggggtgaaatcagagtccgac
cagaagaagtcagaaaatggagccaccttagcgccagaggacacgctgccttttttgaag
tgctattgctcaggacactgccctgatgacgctgtcaataacacatgcataactaatgga
cattgctttgccatcatagaagaagatgaccagggagaaaccacactggcgtcagggtgt
atgaaatatgaagggtctgactttcagtgcaaggattcacctaaagcccagctgcgccgg
accatagagtgctgccgcacccacctgtgtaaccagtatttgcagccgacactgccccct
gctgttgtaggtcctttcttcgatggcagcgtccggtggctggttgtgcttgtgtccatg
gccatctgcatcgttgctatgatcatcttctccagctgcttttgttacaaacattactgc
aagagcatgtccagtcgacgtcgttacaatcgagacttggagcaggatgaggcgtttatc
cccgtgggagagtcgctgaaagacctcatcgaccagtcgcagagctctgggagcggatct
ggccttcctctgctggttcagcgaactatcgccaaacagattcagatggtgcggcaagtt
ggaaagggccggtatggagaagtgtggatgggtaaatggcgtggagagaaagtggcagtc
aaggtgtttttcaccactgaagaggccagctggtttcgagaaacagaaatctaccaaaca
gtgctgatgcgacacgagaacatactcggtttcatagcagcggacattaaaggcacaggc
tcctggactcaactctacctgatcaccgactaccacgagaacgggtccctctatgacttc
ctgaaatgtgccaccctggacaccagagctctgctcaagttggcttactcggctgcctgt
ggtctgtgccacttgcacacagaaatttatggcacccaagggaagcctgccattgcccat
cgagacctgaagagcaaaaacatcctcatcaagaaaaacgggagctgttgtattgctgac
ctgggccttgctgttaaattcaacagtgacacgaatgaagtggatgtgcccctgaacacc
agggtgggcaccaagcgctacatggctcccgaggtgctggacgagagcctgaacaaaaac
cacttccagccctacatcatggcggacatctacagcttcggcctcatcatctgggagatg
gcccgccgctgcgtcacgggagggatcgtggaagagtaccagctgccgtactacaacatg
gtgcccagcgacccgtcctacgaggacatgcgcgaggtcgtgtgcgtcaagcggctgcgg
ccgattgtgtccaaccgctggaacagcgacgagtgcctgcgggccgtgctgaagctgatg
tcagagtgctgggcccacaatccagcctccagactcacggcgctgcggatcaagaagacg
ctggccaagatggtggagtcgcaggatgtaaagatctga

DBGET integrated database retrieval system