KEGG   Oryctolagus cuniculus (rabbit): 100350523
Entry
100350523         CDS       T03373                                 
Symbol
TBKBP1
Name
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100350523 (TBKBP1)
SSDB
Motif
Pfam: TBD Zn-C2H2_12 Knl1_RWD_C CT_C_D Seryl_tRNA_N
Other DBs
NCBI-GeneID: 100350523
NCBI-ProteinID: XP_008269596
Ensembl: ENSOCUG00000014771
LinkDB
Position
19:complement(39588585..39604995)
AA seq 612 aa
MESMFEEDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKEGSLLEVEKVSLQQRLNQFQQELQRN
KEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEQQLRQQQGLRDAAF
PSLSPPPAPAPPCADLDLHYLALRGGSALSHAGWPGPVPSVGELERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQESRAQDLASNQSERDMAWVKRIGDDQVNLALAYTE
LTEELGRLRELSSLQGRILRTLLQEQARSCGQRHSPLSQRHSPAPQCPSPSPPARAAPPC
XSPPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPPCQSPSPQRRSPVPPSCP
APQPRPPPPPPPPADRTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPAWLQA
EAATLPKPRTYGGELYGPARPLSPRRAFEGIRLRFEKQPSEEEEWAVPASPPSPEAGTIR
CASFCAGFPIPESPAAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDALI
KHIDSHLENSKI
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggagtccatgtttgaggaggacatcagcatcctgacgcaggaggccctggggcccagc
gaggtgtggctggacggtcctggagacccctcgctgggcggggacatgtgctccgcctcc
cactttgccctcatcacggcctatggagacatcaaagagcgcctgggaggcctggagagg
gaaaatgccactctgcgccgccgtctcaaagtctatgagatcaagtacccgctgatcagt
gactttggcgaggagcacggcttctccctctatgaaatcaaggagggctccctgctggag
gtggagaaggtcagcctgcagcagcggctcaaccagttccagcaggagttgcagaggaat
aaggagcaggaagaacagctcggggagatgatccaggcttacgagaagctctgtgtggag
aagagcgacttggagacggagctgggcgagatgcgggccctggtggagacgcacctgcgg
cagatctgtggtttggagcagcagctgcggcagcaacaaggccttcgggacgcagccttc
cccagcctgagccccccgcccgcccctgccccgccctgtgctgacctggacctgcactac
ctggcactgagagggggatctgccttgagtcatgcgggctggccaggccctgtgccgagt
gtgggtgagctggagcggcggcgactcgaagaggccctggaggccgcgcagggagaggcc
cggggggcccagctgcgggaggagcagctccaggcggagtgcgagcggctgcagggggag
ctgaagcagctacaggagagccgggcccaggatctggcctccaaccagtcggagcgggac
atggcgtgggtgaaaagaattggggacgatcaggtgaacttggcattggcctacacagag
ctgactgaggagctgggccggcttcgggagttgagttccctgcaggggaggatcctgagg
actctgttgcaggagcaggcccgcagctgcggccagagacactcgccgctgtcgcagcgt
cactccccggccccccagtgcccctcgccgtccccgcccgcccgagccgcgcccccgtgc
nncagtccccccgtcccgcagcgccgctcgcccgtgcccccgtgcccctcgccccagcag
cgccgctcgcccgcctcgccctcgtgcccgtcgcccgtcccgcagcgccgctcgccggtg
ccgccgccgtgccagtcccccagcccgcagcgccgctccccggtgccgcccagctgcccg
gcgccgcagccccggccgccgccgccgccaccgccgcccgcggacaggacgctggcggag
cgcgcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccgccgcagc
tactccgagctggcagagggcgcggcctacgcgggcgcctccccggcctggctgcaggcc
gaggcggccacgctacccaagccgcgcacctacggcggcgagctctacggccctgcgcgg
ccgctcagcccacggcgcgccttcgagggcatccggctgcgcttcgagaagcagccgtcg
gaggaggaggagtgggccgtgcccgccagcccgcccagcccggaggccggcaccatccgc
tgcgcctccttctgtgcgggcttccccatcccggagtcgcccgctgcctatgcccacgcc
gagcacgcgcagtcctggccctccatcaacctgctgatggagacagtgggctccgacatc
cgcagctgccccctctgccagctgggtttccccgttgggtacccggatgacgccctcatc
aaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system