KEGG   Oryctolagus cuniculus (rabbit): 100350589
Entry
100350589         CDS       T03373                                 
Symbol
UBE2Z
Name
(RefSeq) ubiquitin conjugating enzyme E2 Z
  KO
K10585  ubiquitin-conjugating enzyme E2 Z [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350589 (UBE2Z)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350589 (UBE2Z)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100350589 (UBE2Z)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100350589 (UBE2Z)
SSDB
Motif
Pfam: UQ_con UEV RWD UFC1
Other DBs
NCBI-GeneID: 100350589
NCBI-ProteinID: XP_008269556
Ensembl: ENSOCUG00000009159
LinkDB
Position
19:complement(38494835..38514294)
AA seq 311 aa
MCGRRRRRRAGPGGRGAAWLRCRGSRPRAAAHGAALLSHWDPTLSSDWDGERTAPQCLLR
IKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPP
RVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYH
NEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYE
VACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSG
TETDLHGSLRV
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtgtgggcggcggcggcggcggcgggcggggccggggggccggggagcggcctggctc
cgctgccggggctcccgccctcgggccgctgcccacggggccgcgctgcttagccactgg
gaccccacgctcagctctgactgggacggcgagcgaaccgcgccgcagtgtctactccgg
atcaagcgggatatcatgtccatttataaggagcctcctccgggaatgttcgtcgtaccc
gatactgttgacatgaccaagattcatgcattgatcacaggcccatttgacactccttat
gaagggggtttcttcctgttcgtgtttcggtgtccacccgactatcccatccacccgcct
cgggtcaaactgatgacaacgggcaataacacagtgaggtttaaccccaacttctaccgc
aatgggaaggtctgcttgagtattctaggtacgtggactggcccagcctggagcccggcc
cagagcatctcttctgtgctcatctccatccagtccctgatgactgagaacccttaccac
aatgagcctggctttgaacaggagagacatccaggagatagcaaaaactacaatgaatgt
atccggcacgagaccatcagagttgcagtctgtgacatgatggaaggaaaatgtccctgc
ccagagcccttacgaggggtgatggagaagtcctttctcgagtattacgacttctatgag
gtggcctgcaaagatcgcctgcaccttcaaggccagaccatgcaggacccttttggagag
aagcggggccactttgactaccagtccctcttgatgcgcctgggactgatccgtcagaaa
gtgctggagaggctccataatgagaatgctgaaatggactctgatagcagctcgtctggg
acagagacggacctgcacgggagcctgagggtctag

DBGET integrated database retrieval system