KEGG   Oryctolagus cuniculus (rabbit): 100350663
Entry
100350663         CDS       T03373                                 
Symbol
EPS15
Name
(RefSeq) epidermal growth factor receptor pathway substrate 15
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350663 (EPS15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350663 (EPS15)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100350663 (EPS15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7 Crescentin ATG16 HrpB7 TMF_DNA_bd UPF0242 AAA_13 DUF6212 EzrA Fib_alpha DUF3584 HAP1_N
Other DBs
NCBI-GeneID: 100350663
NCBI-ProteinID: XP_008263488
Ensembl: ENSOCUG00000004293
LinkDB
Position
13:115265855..115403218
AA seq 898 aa
MAAAAQLSLTQLSSGNPVYEKYYRQVDTSNTGRVLASDAAVFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMTLPAALMPPSKRKTWVVSPVEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSTLLAHIWALCDPKSCGKLSKDQFALAFHLINQKLIKGIDPP
LILTPEMIPPSDRTSLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEINAMQMKLMEMKDLENHNNQLNWCSSPHSVLVNGTTDYCSLSTSSSETANLN
EHAECQSNLESEPIHQESPARSSPEIPPSVVTDENAVVAAAVTEKVCPEFDNERHSKEED
PFNAESSSLTDPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFRGSDPFASDCFF
KQSSTDPFATSSTDPFSAASNSSNTSVETLKHNDPFAPGGTVVVAASDSATDPFASVFGN
ESFGDGFADFSTLSKVNNEDPFSSATSNSVSNVVTTKNVFEETSVKNEDVPPALPPKIGT
PTRPCPPPPGKRSINKLDSSDPFKLNDPFQPFPGNDSPKEKEPDMFCDPFTSTTTTSKEA
DPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggctgcggcagcccagctctccctgacacagttatcaagtgggaaccctgtatatgaa
aaatactatagacaggttgataccagcaatactggaagagtgttggcttctgatgctgct
gttttcctgaaaaaatcaggtcttccagacttgatacttggcaagatctgggatttagct
gacacagatggcaaaggtatcctgaacaaacaagaattcttcgttgctttgcgccttgtg
gcctgtgcccagaatggattggaggtttcactgagtagcttgaacctggctgttcctcct
ccaagatttcatgataccagtagtcctttgctaatcagtggaacctctgcagctgagctc
ccatgggctgtaaaacctgaagataaggccaaatatgatgcaatttttgatagtttaagc
ccagtcaacggatttctgtctggtgataaagtgaaaccagtgttgctcaattccaagtta
cctgtggatatccttggaagagtttgggaattgagtgatattgaccatgatggaatgctt
gacagagatgagtttgcagttgccatgtttttggtatactgcgcactggagaaagaacct
gtgccaatgaccttgcctgcagccttgatgccaccttctaagagaaaaacgtgggttgta
tctcctgttgaaaaagctaaatatgatgaaatcttcctgaaaactgataaggacatggat
ggatttgtatctggattggaggtccgtgaaatctttctgaaaacaggtttaccttctacc
ttactggctcatatttgggcattatgtgacccaaagagctgtgggaaactttcaaaagat
cagtttgccttggcttttcacttaatcaatcaaaagttaataaaaggcattgatcctcct
ctcattctcactcctgagatgattccaccatcagataggacgagtttacaaaagaacatc
ataggatcaagtcctgttgcagatttctctgctattaaggagctagatacccttaacaat
gaaatagttgacctacagagggaaaagaataatgtggaacaggaccttaaggagaaagaa
gatactattaaacagagaacaagcgaggtgcaggatcttcaagatgaagttcaaagggaa
aatactaacctacaaaaactacaggcccagaaacagcaagtgcaggaacttctcgatgaa
ctggacgaacagaaagcccaactggaggagcaactcaaggaagtcagaaagaaatgtgct
gaggaagcccagctgatctcatctctgaaagctgaattaactagtcaggaatcacagatc
tctacttatgaagaagaattggccaaagctagagaagagctaagccgcctccagcaagaa
acagcagaactagaggagagtgtggagtcagggaaagcccagctggaaccccttcagcag
cacctacaagattcacaacaggagatcaatgcaatgcaaatgaaactaatggaaatgaaa
gatctggaaaatcataataatcaattaaattggtgcagtagcccacacagcgttcttgta
aatggcactacggattactgcagcctcagcaccagcagcagtgaaacagccaaccttaat
gaacacgctgaatgccagagcaacctggaatctgagcccatacatcaggagtctccagca
agaagtagtcctgaaataccaccttcggttgtgactgatgaaaacgcagtggtggctgca
gctgttactgagaaagtttgtcctgaatttgacaatgagaggcattcaaaagaggaggat
ccatttaatgcagaatcaagttcactgacagatccagttgcagatacaaacttagatttt
ttccagtctgatccttttgttggcagtgatcctttcaaggatgatccttttggaaaaatt
gatccatttggtggtgatccctttagaggttctgatccatttgcatctgactgcttcttc
aagcaatcttctactgatccttttgccacttcaagtactgaccctttcagtgcagccagc
aacagcagtaatacatcggtagaaacactgaaacataatgatccttttgcgcctggtgga
acagttgtggttgcagcaagtgattcagccacagacccctttgcctctgtttttggaaat
gaatcatttggagatggatttgctgacttcagcacattgtcaaaggtcaacaatgaagat
ccttttagttcagccacatcaaactccgtcagcaatgtggtcactacaaaaaatgtgttt
gaagaaacatcagtcaaaaatgaagatgtacctccagcactgccaccaaagatcgggact
ccaacaagaccctgcccaccaccacctgggaaaagatccatcaacaaattggattcttct
gatccctttaaactgaatgatccatttcagcctttcccaggcaatgatagccccaaagaa
aaagaacctgatatgttttgtgatccattcacttctactaccactaccagtaaagaggct
gacccaagcaattttgctaacttcagtgcttatccctctgaagaagatatgattgagtgg
gccaagagggaaagtgagagagaggaagagcagaggcttgcccggctgaatcaacaagag
caagaagacttagaactggctattgcactcagcaagtctgagatttcagaagcatga

KEGG   Oryctolagus cuniculus (rabbit): 100352462
Entry
100352462         CDS       T03373                                 
Symbol
EPS15L1
Name
(RefSeq) epidermal growth factor receptor pathway substrate 15 like 1
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352462 (EPS15L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352462 (EPS15L1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100352462 (EPS15L1)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 EzrA Crescentin EF-hand_8 TelA EF-hand_5 LMBR1 CALCOCO1 DUF745 BicD ATG16 DUF4763 MPS2 MAD DUF16 HMMR_N DUF4201 Prominin
Other DBs
NCBI-GeneID: 100352462
NCBI-ProteinID: XP_008247550
LinkDB
Position
Un
AA seq 809 aa
MPPPKFHDTSSPLMATPPSTDAHWAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNS
KLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSVLPPTLIPPSKRKKT
VFPGAVPVLPASPPPKDSLRSTPSHGSVSSLNSTGSLSPKHGIKQTQPAATSWVVPVADK
MRFDEIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALA
MYFIQQKVSKGIDPPQVLSPDMVPPSERGTPVPDSSSSLGSGEFTGVKELDDISQEIAQL
QREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQK
AKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEEAQLE
QSIQAGRVQLETIIKSLRSTQDEINQARSKLSQLHESRQEAHRSLEQYSQALDGVHGASL
SDLADLSEGISLAERGGFGAMDDPFKNKALLFSNNTQDSHADPFQAEDPFKSDPFKGADP
FKGDPFQNDPFAEPQTASTDPFGGDPFKESDLFRGSASDDFFRKQTKNDPFTKNPPLPSK
LDPFESSDPFSSSSVSSKGSDPFGTLDPFGSGAFSSAEGFADFSQMSKPPTSGPFTSSLG
GAAFPDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADG
GDPFQNKQGFGDPFSGKDPFVPSSAAKAPKASSSGFADFSSFGNEEQQLAWAKRESEKAE
QERLARLRRQEQEDLELAIALSKADMPAA
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgccgccacctaagttccacgacaccagcagccccctgatggccacgccgccgtccacg
gacgcccactgggccgtgcgggtggaagaaaaggccaagtttgatggaatttttgaaagc
ctcttacctatcaatggtttgctctctggagacaaggtcaagccagtcctcatgaactct
aagctacctcttgacgtcctgggcagggtctgggacctcagcgacatcgacaaggacggg
cacctggaccgagacgagttcgctgtggccatgcacttggtttaccgagccctggagaag
gagcccgtgccctccgtgctgccgcccaccctcatcccaccctccaagaggaagaagacg
gtgttccccggcgctgtgcctgtcctgcctgccagccccccgcccaaagacagcctgcgc
tccaccccttcccacggcagcgtgagcagcctcaacagcaccggcagcttgtctcccaag
catggcatcaaacagacgcagccggcggcgacaagctgggtggtgccggtggcggacaag
atgcgcttcgacgagattttcctgaagaccgacctggacctggacggctacgtgagcggc
caggaggtgaaggagatcttcatgcactcgggcctcacccagaacctcctagcgcacata
tgggccctggccgatacgaggcaaacggggaagttaagcaaagaccaattcgcgttagct
atgtatttcattcagcagaaggtcagtaaaggcatcgacccccctcaagtcctctcgccc
gacatggtcccgccctcagagagaggcaccccggtcccggacagttccagttctctggga
tcgggggagttcacgggagtgaaagagctggacgatatcagtcaagagatcgcccagtta
cagagagagaagtactcgctggagcaagacatccgggaaaaggaggaggcgatcagacag
aagaccagcgaggtgcaggaactgcaaaatgacctagaccgggagacgagcagtttgcaa
gagctcgaagctcagaaacaggatgcccaggaccggctggacgagatggaccagcagaag
gccaagctccgggacatgctgagtgatgtgcggcagaagtgccaggacgagactcagatg
atctcgtcgctgaagacgcaaatccagtcgcaggagtccgacctgaagtcgcaggaggat
gacctgaaccgggccaagtcggagctgaaccggctgcagcaggaggaggcccagctggag
cagagcatccaggccgggcgggtgcagctggagaccatcatcaagtccctgaggtccacg
caggacgagatcaaccaggcgaggagcaagctttcccagctgcacgagagccggcaggag
gcccacaggagcctggagcagtacagccaggccctcgacggggtgcacggcgccagcctg
agcgacctggccgacctgagcgaaggcatctccctggccgagaggggaggttttggagcc
atggacgatcctttcaaaaataaagccttgttatttagcaacaacacccaggactcgcat
gcggatcctttccaggccgaagaccccttcaagtccgacccgtttaaaggcgcagacccc
ttcaaaggcgacccattccagaatgacccctttgccgagccacagacggcgtccacagat
ccattcggaggggaccctttcaaagagagcgacctgttccgcggctccgcctccgacgac
ttcttcaggaagcagaccaagaatgacccgttcacgaagaaccctcccttaccctccaag
ctcgacccctttgagtccagcgatcccttctcgtcctccagtgtctcctcgaaaggctca
gatccctttggaaccctggaccccttcgggagcggggctttcagcagcgctgagggcttt
gctgacttcagccagatgtccaagcccccaacttctggccctttcacctcctccctggga
ggggcagcattcccagatgacccctttaaaagtaaacaggacactcctgctctgcctccg
aagaagcctgctccgccacggcctaagccgcccagcggtaaaagcacacctgtaagccag
ctcggctctgcagacttccccgaggcccccgatccgttccagccactcggggctgacggc
ggcgacccgttccaaaataagcagggctttggggacccgtttagtggaaaagacccgttt
gtcccctcctctgcagctaaggctcccaaggcctcctcctcgggctttgcagacttcagt
tcttttggcaatgaggagcagcagctggcctgggccaagcgggagagcgagaaggccgag
caggagcggctggcgcggctgcggcggcaggagcaggaggacctggagctggccatagcg
ctgagcaaggccgacatgccggccgcctag

DBGET integrated database retrieval system