KEGG   Oryctolagus cuniculus (rabbit): 100350794
Entry
100350794         CDS       T03373                                 
Symbol
IL17RE
Name
(RefSeq) interleukin 17 receptor E
  KO
K05168  interleukin 17 receptor E
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350794 (IL17RE)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100350794 (IL17RE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100350794 (IL17RE)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL17 receptor family
   100350794 (IL17RE)
SSDB
Motif
Pfam: IL17_R_N SEFIR
Other DBs
NCBI-GeneID: 100350794
NCBI-ProteinID: XP_008248158
Ensembl: ENSOCUG00000005311
LinkDB
Position
Un
AA seq 717 aa
MGSPGWAPLLLLAVGLCASGGIVCSRSPCWSTHGLLALHTARCHCQESSFTGSPACAPCS
TLLALLPGRLRLVPVWHLRVASDASGLQRGCFCLSAWKSRKSYTFRFCRRPRMPAPAQAP
EEETGPGPPASQPAAHCALCPQRKLLGRRCLSGKGRHVSVPCLDTCPRGLRSKRTQPWDP
FSAARGPGLGSQRRGGPDFSFELLPEARVIRATVPPGPEVLLRLCHQWALECEEPSSPFD
AQKIVSGGHTADLPYEFLLPCLCIEAFHLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFSD
YSQRDQMAMALTLRCPLRLEASLCQKQEGHTLCEDVPNATARESEGVRTDLPCPSPTRAG
GGQDRGPGPSACLPALSPQWYILDKVDLHPQLCFKFSVGNSSHVECPHQTGACTSWNVSM
DTRARQLILHFSSTVQATFSAAWSHPGLGHDPLTSPVYSVSQTQGSGPVTLDLVIPFLRP
GGCVLVWRSDVQFASKRLLCPDVSHRRLGLLILALLALATLLGVVLVLTCCHPLSGPGPA
RPVLLLHVAESQEQRRLVGALAELLRTALGGGRDVIVDLWEGTRVAHVGPLPWLWAAQAR
VLRERGTVLLLWGPAGGSDPCTAPLHALLGAAPRPLLLLAYFSRLCAKGDIPRPLRVLPR
YRLLRDLPRLLRALGARPGTGTVAAGPDCLGARQGLRGRLELCRRLEREAATVAGHV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggggagccccggatgggcgcccctgctcctgctggccgttggcctctgtgcctctggt
gggatcgtctgttcccgctcgccctgctggagcacccacggccttctggcccttcacaca
gcgaggtgccattgccaggagagcagttttactggaagccctgcctgtgcaccctgcagt
accctgttggcgctgctccccggaaggctccggctcgttccggtctggcacctgcgtgtg
gcgtcagatgcctcaggccttcagaggggctgcttctgcctctccgcgtggaaatccagg
aagtcttacacgttcaggttctgtaggagacccaggatgccggcgcctgctcaggctcca
gaggaggaaacaggccccggaccccctgcttcccagcccgcggcccactgtgctctctgc
ccgcagaggaagctcctaggtcgccgttgcctgtctgggaagggccgtcacgtttccgtg
ccctgcctggatacctgccccagggggctgcgctccaaaaggacccagccttgggaccca
ttctcagcagcacgtggccccggcctgggctcgcagaggcgtggagggcctgacttctcc
ttcgagctgctacctgaggctcgggtgattcgggcgaccgttccgccaggccccgaggtc
cttctgcgtctttgtcatcagtgggcactggaatgtgaagagccgagcagccccttcgat
gcccagaaaatcgtgtctgggggccacactgctgacctgccgtacgaattcctcctgccc
tgcctgtgcatagaggcattccacctgcaagaggacaccgtgaggcgcaagaagtgtccc
ttccagagctggcccgaagcctatggctcagacttctggaagtcggtacacttcagcgac
tatagccagcgcgatcagatggccatggccctgaccctccgctgtccgctgaggctggag
gcctccctgtgtcagaagcaagaggggcacaccctctgcgaagacgtccccaatgccaca
gctcgagagtcagagggggtgaggacagaccttccctgcccctcccccacaagggccggt
ggtgggcaggaccggggcccagggccttctgcctgcctgcctgctctctccccacagtgg
tatattttggacaaggtggacttacaccctcagctctgcttcaagttctccgtgggaaac
agcagccatgtggaatgtccccaccagactggggcttgcacatcctggaacgtgagcatg
gatacccgggcccggcagctgatccttcacttctcctcgacggtgcaggccaccttcagt
gctgcctggagccacccaggcttggggcacgaccccttgacatcccccgtgtacagtgtc
agccagacccagggctcaggcccagtgacactggacctcgttattcccttcctgaggccg
gggggctgtgtcctggtatggaggtcagatgtccagtttgcctcgaagcgcctcttgtgt
ccagatgtctctcacagacgcctggggctcttgatcctggctctgctggccctcgccacc
ctactgggcgtggtcctggtcctcacctgctgccacccactgtcaggcccaggcccagca
cggccggtgctgctcctgcacgtggcggagtcccaggagcagcggcgcctcgtgggagcg
ctggctgaactgctgcggacggcgctgggcggcggccgggatgtgatcgtggacttgtgg
gaggggacgcgcgtggcgcacgtgggccctctgccgtggctgtgggcagcgcaagcgcgc
gtgctgcgggagcggggcacggtgctgctgctgtggggccctgccggcggctccgacccc
tgcaccgcgcccctgcacgccctgctcggcgccgcgccccgaccgctgctgctgctcgcg
tacttcagccgcctctgcgccaagggcgacatccctcggccgctgcgcgtgctgccgcgc
taccgcctgttgcgcgacctgccgcgcctgctgcgggctctgggcgcgcgccccggtacc
ggtaccgtagccgcgggcccggactgcctcggagctcggcagggcttgcggggccgcctg
gaactttgccgccggctggaacgcgaggctgccacggttgccggccacgtctga

DBGET integrated database retrieval system