KEGG   Oryctolagus cuniculus (rabbit): 100350821
Entry
100350821         CDS       T03373                                 
Symbol
IL17RB
Name
(RefSeq) interleukin 17 receptor B
  KO
K05165  interleukin 17 receptor B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350821 (IL17RB)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100350821 (IL17RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100350821 (IL17RB)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL17 receptor family
   100350821 (IL17RB)
SSDB
Motif
Pfam: SEFIR IL17R_fnIII_D1 IL17R_fnIII_D2 Pro-rich_19
Other DBs
NCBI-GeneID: 100350821
NCBI-ProteinID: XP_002713439
Ensembl: ENSOCUG00000013508
LinkDB
Position
9:20810594..20824275
AA seq 490 aa
MSLVLLSLAALCRSALPREPTVQCGSETGPSPEWLVQHTLTPGDLRDLRVEPVTTKVAVE
DYSVLMNVSWVLRADASIRVLKATKICVTGKSSLQSYSCVRCNYTEAFQSQTRSSGHKWA
FSYVGFPVELNTLYFIGAHNIPNANMNGDGPSLSVNFTSPGCLDHIMKYKKKCIEAGSLW
DPNITACKKNETTVQVKFTTSLLGNKYMALVRQGAVIGFSTVLEDKLTRTSVEVPVRGDS
HGAVVQLTPYFRTCGNDCIRRKGTVVLCPQPDTPSLPDTSRSVLGSWLPLLLLPLLVAVW
VLAAGICLRWRHGRTQMASFPATTLLPRAKVVVVYPSEVCFHHTVCGFAEFLQSHCRSEV
ILDKWQQQKVAELGPVLWLTTEKQAADRVIFLLSNELSAQCDGTCAGGEGGPQRGSQDLF
VLAYNLLCSDIGSQTHACKYLVVYFSQPPAAAGYSALRLCPRFHLWRDAAALRTQLLRVT
QQGPVGCSSL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcgcttgtgctgctgagcctggccgcgctgtgcaggagcgccttgccccgagagccg
actgttcaatgcggctctgaaacggggccatctccagagtggctggtccagcacaccctg
accccaggggatttgagggacctccgagtggaacctgttacgaccaaggttgcagtggag
gactactcggttttgatgaacgtaagctgggttctccgggcagatgccagcatccgcgtg
ctgaaggccaccaagatctgcgtgacgggcaaaagcagcctgcagtcctatagctgtgtg
cggtgcaattacacagaggccttccagagtcagaccagatcctcggggcacaaatgggcg
ttttcctacgtgggcttccctgtggagctgaacacactgtacttcatcggggcccataac
atccccaacgcaaacatgaacggagatggcccttctctgtcagtgaacttcacctcccca
ggctgcctagaccacatcatgaaatataaaaagaagtgcatcgaggcaggcagtctgtgg
gatcccaacatcaccgcctgtaagaagaacgagacgacagtccaagtgaagtttacgacg
agtctccttggcaacaagtacatggctcttgtgcgtcagggcgccgtgattgggttttcc
accgtgctggaggacaagctgacacggacgtcggtggaggttccagtgagaggcgacagc
cacggtgccgtggttcagctgaccccgtatttccgcacctgtggcaacgactgcatccga
cgcaaaggaactgttgtgctttgcccacagccagacacccccagcctcccagacaccagc
agaagcgtgctaggaagctggctccctctcctcctcctgccgctgctggtggccgtgtgg
gtgctggcagctgggatctgtctaaggtggaggcacggcaggacccagatggcttccttt
ccagccaccacgctgctgccccgcgccaaggttgttgtggtttacccgtctgaagtctgt
ttccatcacaccgtctgtggcttcgcggagtttctccagagccactgcagaagtgaggtc
atccttgacaagtggcagcagcagaaggtcgcggagctgggtcccgtgctgtggctcacc
actgagaagcaggccgccgacagggtcatcttcctgctctccaacgagctcagcgcccag
tgtgacggcacctgtgcggggggcgagggcggcccccagaggggctcccaggacctgttc
gtcctcgcctataacctgctctgcagcgatatagggagccagacgcacgcgtgcaagtac
ctggtggtctacttcagccagcctcccgccgcggccggttacagcgctctccggctctgc
ccccggttccacctctggagggacgcggccgccctgcgcacgcagctccttcgcgtcacg
cagcaggggccggtgggctgctcctccctgtag

DBGET integrated database retrieval system