KEGG   Oryctolagus cuniculus (rabbit): 100350951
Entry
100350951         CDS       T03373                                 
Symbol
TNFRSF13C
Name
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100350951 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350951 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100350951 (TNFRSF13C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350951 (TNFRSF13C)
  09163 Immune disease
   05340 Primary immunodeficiency
    100350951 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100350951 (TNFRSF13C)
   04090 CD molecules [BR:ocu04090]
    100350951 (TNFRSF13C)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100350951 (TNFRSF13C)
CD molecules [BR:ocu04090]
 Proteins
  100350951 (TNFRSF13C)
SSDB
Motif
Pfam: BaffR-Tall_bind
Other DBs
NCBI-GeneID: 100350951
NCBI-ProteinID: XP_008273381
LinkDB
Position
Un
AA seq 209 aa
MRRGGRSRRGRDGPAPTSCVQAQCFDPLTRHCVACYLLHMQESRPVSPPSDLHRPRSSLP
SVPCPPSPSPPPAAGASSLAPGTALQPQESVGTGIPDGALPLPGLLFGAPVLLGLALALA
LALLALVSWKRRRRWPGVPSPEARDGDQEESLDDVIVFSPGCPDATAPNSPPPGEEAGTA
PPSHSIPVPATELGSTELVTTKTAGPEQQ
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaggcgaggaggacgcagccggcggggcagggacgggccagccccgacgtcctgcgtc
caggcccagtgctttgacccgctgacccgccactgcgtggcctgctacctcctccacatg
caggagtcccggccggtctcacctccctccgaccttcaccggccccggtcgtccctcccc
tcagtcccatgccctccctccccgtcccctccgccagcagcgggggccagcagcttggcg
ccgggcacagcgctgcagccgcaggagtccgtgggcacggggatccccgatggggcactg
ccactgcctgggctgctcttcggcgcccctgtgctgctgggcctggcgctggcgctggcg
ctggcgctgctggctctggtgagctggaagcggcggcggcggtggccaggggtgccctcc
cctgaggcccgggacggagaccaggaagagtccctggatgatgtcattgtcttctccccg
ggatgcccggatgccacagctcccaactcacccccaccgggagaagaagcaggcaccgcc
ccacccagccacagcatccctgtgccggccacagagctgggctccactgagctggtgacc
accaagacggccggccctgagcaacagtag

DBGET integrated database retrieval system