Oryctolagus cuniculus (rabbit): 100351037 Help Entry 100351037         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100351037  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100351037  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100351037   09162 Cancer: specific types    05210 Colorectal cancer     100351037    05222 Small cell lung cancer     100351037   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100351037    05161 Hepatitis B     100351037    05160 Hepatitis C     100351037    05164 Influenza A     100351037    05162 Measles     100351037    05163 Human cytomegalovirus infection     100351037    05167 Kaposi sarcoma-associated herpesvirus infection     100351037    05169 Epstein-Barr virus infection     100351037   09171 Infectious disease: bacterial    05134 Legionellosis     100351037    05152 Tuberculosis     100351037   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100351037   09164 Neurodegenerative disease    05010 Alzheimer disease     100351037    05012 Parkinson disease     100351037    05014 Amyotrophic lateral sclerosis     100351037    05016 Huntington disease     100351037    05017 Spinocerebellar ataxia     100351037    05020 Prion disease     100351037    05022 Pathways of neurodegeneration - multiple diseases     100351037   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100351037    05416 Viral myocarditis     100351037   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100351037   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100351037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100351037 NCBI-ProteinID:  XP_008271136 LinkDB All DBs Position X:complement(65882419..65883301) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAFGFSYTDAHKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIMKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggcctttggattctcctacacagacgcccacaagaacaaaggcatcacctgg ggagaggacactctgatggagtatttggagaatcccaagaagtacatccctggaaccaaa atgatcttcgctggcattatgaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

DBGET integrated database retrieval system