KEGG   Oryctolagus cuniculus (rabbit): 100351063
Entry
100351063         CDS       T03373                                 
Symbol
STAMBP
Name
(RefSeq) STAM binding protein
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351063 (STAMBP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100351063 (STAMBP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351063 (STAMBP)
   04121 Ubiquitin system [BR:ocu04121]
    100351063 (STAMBP)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100351063 (STAMBP)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M67
   100351063 (STAMBP)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Others
   Others
    100351063 (STAMBP)
Ubiquitin system [BR:ocu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    100351063 (STAMBP)
SSDB
Motif
Pfam: USP8_dimer JAB Prok-JAB DUF5876
Other DBs
NCBI-GeneID: 100351063
NCBI-ProteinID: XP_002709784
Ensembl: ENSOCUG00000003657
UniProt: G1SK56
LinkDB
Position
2:complement(112624716..112664484)
AA seq 432 aa
MPQNIFVLMSDHGDVSLPPEERVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSE
EGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLK
RYTKEYTEYNEEKKKEAEEFARNMAIQQELEKERQRVAQQKQQQLEQEQFHAFEEMIRNQ
ELEKERLKIVQEFGKVDPGLGGPLVPDLEGPPVPVFPTSPVSPTPPSDCNTAVRPTKPPV
VDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRN
EFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTH
CSYQMMLPESIAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVT
VVDRAVTITDLR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgccgcagaacatcttcgtcctgatgtctgaccatggagatgtgagcctcccacccgaa
gagcgggtgagggctctctcccagctggggagtgcagtggaggtgaatgaagacatccca
ccccgtcggtacttccgctctggagttgagattatccgaatggcatccatttactctgag
gaaggcaacattgaacatgccttcatcctctataacaagtatatcacactctttattgag
aaacttccaaagcatcgagattacaaatcggctgtcattcctgaaaagaaagacacggta
aagaaattaaaggagattgcatttcccaaagcagaagaactgaaggctgagctgttaaaa
cgatacaccaaagaatatacagaatataatgaggaaaagaagaaggaagcagaggaattt
gcccggaatatggccatccagcaagagctggaaaaggagagacagagggtagcacaacag
aagcagcaacaactggaacaggaacagttccatgcctttgaggagatgatccggaaccag
gagctggaaaaagaacgactgaaaatcgtacaggagtttgggaaggtggatcctggctta
gggggtccgctggtgcctgacttggaagggcctcctgtacctgtgttccccacctcacct
gtctcacccacgccgccttcagactgtaacactgctgtaaggccaactaagccacctgtg
gtggaccggtccttgaagcctggagcactgagcaactcagaaagtattcctacaattgat
ggattacgccatgtggtggtgcctgggaggctatgcccacagttcctccagttagccagt
gccaacactgcccggggagtagagacatgtggaattctctgtggaaaactgatgaggaat
gaatttaccatcacccatgttctcatccccaagcaaagtgctgggtctgattactgcaat
acagagaacgaagaagaactgttcctcatccaggatcagcagggtctcatcacactgggc
tggatccacacgcatcccacccagactgcctttctctccagtgttgacttgcacacgcac
tgctcctaccagatgatgttgccggagtccattgccatcgtttgctctcccaagttccag
gaaactggattttttaaactgaccgaccatgggctagaagagatctcttcctgtcgccag
aagggatttcatccgcacagcaaggatccacctttgttctgtagctgcagccacgtgact
gttgtggacagagcggtgaccatcacagacctccgatga

DBGET integrated database retrieval system