KEGG   Oryctolagus cuniculus (rabbit): 100351202
Entry
100351202         CDS       T03373                                 
Symbol
VPS35
Name
(RefSeq) VPS35, retromer complex component
  KO
K18468  vacuolar protein sorting-associated protein 35
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351202 (VPS35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351202 (VPS35)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    100351202 (VPS35)
SSDB
Motif
Pfam: Vps35 FerA DUF758 Imm5 ADIP
Other DBs
NCBI-GeneID: 100351202
NCBI-ProteinID: XP_008246603
Ensembl: ENSOCUG00000010484
UniProt: G1SZE0
LinkDB
Position
Un
AA seq 796 aa
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSP
KSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVK
SFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDIGDSM
DFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIII
ALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMK
CYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
FHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPD
PEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLA
FRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHE
TVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQCALSASKL
LKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMDPSLQVQLF
IEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNTLEHLRLR
RESPESEGPIYEGLIL
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgcctacaacacagcagtcacctcaggatgagcaggaaaagctcttggatgaagccata
caggctgtgaaagtccagtcattccaaatgaagagatgcctggataaaaacaagctcatg
gatgctctgaaacatgcttctaatatgcttggtgaactgcggacttctatgttatcacca
aagagctactatgaactttatatggctatttctgatgaactgcactacttagaggtctac
cttacagatgagtttgccaaaggaagaaaagtggcagatctctatgaacttgtacagtat
gctggaaacattatcccaaggctttatctgttgatcacagttggagttgtatatgtcaag
tcatttcctcaatccaggaaagacattttaaaagatttggtagaaatgtgccgtggtgtg
caacatcccttaaggggtttatttcttcgaaattatcttcttcaatgtactagaaacatc
ttacctgacgaaggagagccaacagatgaggaaacaaccggagatatcggtgattctatg
gactttgtactactcaactttgcagaaatgaacaagctctgggtgcgaatgcaacatcag
ggtcatagccgagatagagaaaaaagagaacgagaaagacaagaactgagaattttagtg
ggaacaaatttggtgcgcctcagtcagttggaaggtgtaaatgtggaacgttataaacag
attgttttgactggcatattggaacaagttgtaaattgtagggatgctctggctcaagaa
tatctcatggaatgtattattcaggtttttcctgatgaattccacctccagactttgaat
ccttttctccgggcctgtgctgagttacaccaaaatgtaaatgtgaaaaacataatcatt
gctttaattgacagattagctttatttgcccaccgtgaagatggacctggaatcccagca
gatattaaactttttgacatattttcacagcaggtggctacagtgatacagtctagacaa
gacatgccatcagaggatgttgtatctttacaagtctctctcattaatcttgccatgaaa
tgttaccctgatcgtgtggactatgttgataaagttttagagacaacagtggaaatattc
aataagctgaaccttgaacatattgctaccagtagtgcagtttcaaaggagctcaccaga
cttctgaagatacctgttgatacttataataatattttaactgtattgaaattgaaacat
tttcacccactttttgagtactttgactatgaatccagaaagagcatgagttgttatgtg
cttagtaatgttctggattataatacagaaattgtatctcaagaccaggtggattccata
atgaatttagtatccacgttgattcaagatcagccagatcaacctgtagaagaccctgat
ccagaagactttgctgatgagcaaagccttgtgggccgattcattcatttactgcgatcc
gaggaccctgatcagcagtacttgattttaaacacagcacgaaaacattttggagctggc
ggaaatcagcggattcgcttcacactgccacctttggtgtttgcagcttaccagctggct
tttcgatacaaagagaattctaaagtggatgacaaatgggaaaagaaatgccagaagatt
ttttcatttgctcaccagactatcagtgctttgataaaagcagagctggcagaattaccc
ttgagactttttcttcaaggagcacttgctgctggagaaattggttttgaaaatcatgag
acagtagcatatgaatttatgtcccaggcattttctctgtatgaagatgaaatcagtgat
tccaaagctcagctggctgccatcaccttgatcatcggtacttttgagaggatgaagtgc
ttcagtgaagagaatcatgagcccttgaggactcagtgtgcactttctgcatccaaactt
ctcaagaaacctgatcagggccgagctgtgagcacctgtgcacatctcttctggtctggt
agaaacacagacaaaaatggggaggagcttcatggaggcaagagggtaatggagtgccta
aaaaaagctctaaaaatagcgaatcagtgcatggacccctctcttcaagtgcagcttttt
atagaaattctaaacagatatatctatttttatgaaaaagaaaatgatgcggtaacaatt
caggttttgaaccagcttatccaaaagattcgagaagacctcccaaatcttgagtccagt
gaagaaacagagcagattaacaaacattttcataacacactggagcatttgcgcttgagg
cgggaatcaccagaatctgaggggccaatttatgaagggctcatcctttaa

DBGET integrated database retrieval system