KEGG   Oryctolagus cuniculus (rabbit): 100351716
Entry
100351716         CDS       T03373                                 
Symbol
GDF10
Name
(RefSeq) growth differentiation factor 10
  KO
K22674  growth differentiation factor 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100351716 (GDF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100351716 (GDF10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100351716 (GDF10)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 100351716
NCBI-ProteinID: XP_017195093
LinkDB
Position
Un
AA seq 476 aa
MARGPARTGPRPEPPLLPLLPLFLLLLRDAGGSHTAPAWSAASDGLRGDEDPQPSPGDAT
AALGPGAQDMVAVHMLRLYEKYSRRGARPGAGNTVRSFRARLDVVDQKAVYVFNLTSMQD
SEMILTATFHFYLEQQRRWPPASLLTTTFINFALEYYGARTLLLRSLPHNAATQGLLRAA
LALAPPPPPRGLWQARDISAVVQAARRDGELLLSAQLDPGDKSPGLHRPGAHAPYILVYA
NDLAISEPNSVAVTLQRYDPFQTGDPEPRPAPNGSSDPRVRRAAAQASGPLHDNELPGLH
ERRAPAVAHGPRHHKHELWPGPLRALRPRPGRRDRRRKGPELFAASAASSQVLDFDEKTM
QKARRRQWDEPRVCSRRYLKVDFADIGWNEWIISPKAFDAYYCAGACEFPMPKVVRPSNH
ATIQSIVRAVGVVPGVPGPCCVPDKMSSLGVLFLDESRNVVLKVYPNMSVETCACR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctcgtggccccgctcggaccggtccgaggccggagcccccgctgctaccgctgctg
ccgctgtttctgctgctgctccgggacgcaggcggcagccacacagcccctgcctggtcc
gcggcctccgatggcctgcgaggggacgaggacccgcagccgtccccgggggacgcgacc
gccgcactgggtcctggcgcccaggacatggtcgctgtccacatgcttcggctttatgag
aagtacagccggcggggcgcacggcctggagctggcaacacggtgcgcagcttccgtgcc
cggctggacgtggtcgaccagaaggccgtgtatgtcttcaatctgacgtccatgcaggat
tcggagatgatcctcacggccacctttcacttctacctggagcagcagcggcggtggccc
ccggcgagcctccttaccactacatttatcaatttcgctctagaatattacggcgcccgc
accctgctcctccgcagcctcccgcacaacgcggccacgcaggggctgctccgcgctgcc
ctggccctggcgccgccgccgccgccgcgcggcctatggcaggcccgggacatctcagcc
gtggtccaggcggcccgcagagacggcgagctgctcctgtccgctcagctcgaccccggg
gacaagagcccaggactgcacaggcccggcgcccatgcgccctacatcctcgtctacgcc
aacgatctggccatctcggagccaaacagcgtggccgtgaccctgcagcgatacgacccc
ttccagaccggggaccccgagccgcgcccggcccccaacggctccagcgacccccgcgtg
cgccgggcggccgcgcaggcctccgggcctctgcacgacaacgaactgcccgggctgcac
gagaggcgggcgccggccgtggctcacggcccgcgtcaccacaagcacgagctgtggccg
ggccccttgcgagcgctgaggccaaggccggggcgcagggaccggcgcaggaagggcccg
gagctgttcgccgcctccgccgcctcctcgcaggtgctggacttcgacgagaaaacgatg
cagaaagcccgcaggaggcagtgggatgagccccgggtctgctcccggaggtacctgaag
gtggacttcgcagacatcggctggaacgagtggatcatctcacccaaggccttcgatgcc
tactactgtgcgggcgcctgcgagttccccatgcccaaggttgtccgcccgtccaaccac
gccaccatccagagcatcgtcagggccgtgggtgtggtgcccggcgtgccggggccctgc
tgcgtccccgacaagatgagctccctcggggtgctgttcctggacgagagtcggaacgtg
gttctgaaggtgtaccccaacatgtccgtggagacctgcgcctgccgctaa

DBGET integrated database retrieval system