KEGG   Oryctolagus cuniculus (rabbit): 100351788
Entry
100351788         CDS       T03373                                 
Symbol
IL13RA1
Name
(RefSeq) interleukin 13 receptor subunit alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100351788 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100351788 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100351788 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100351788 (IL13RA1)
   04090 CD molecules [BR:ocu04090]
    100351788 (IL13RA1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   100351788 (IL13RA1)
CD molecules [BR:ocu04090]
 Proteins
  100351788 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 LIFR_N EpoR_lig-bind LIFR_D2 DUF4469
Other DBs
NCBI-GeneID: 100351788
NCBI-ProteinID: XP_008271141
Ensembl: ENSOCUG00000013687
UniProt: G1T5Y0
LinkDB
Position
X:67449037..67522217
AA seq 519 aa
MVEEVWVGRGRGSGAPAGGGGAAPRSGVAPQEPPAPRLSAPARRLGLPAAGGRGRLPVCA
GPQPPGRLSREVGEGAEEAETAEVPARPGSEARGCMERPAWFCGLLALLLCASGSGDAAP
TETQPPVTNLSVSVENLCTIIWTWNPPEGASPNCSLRYFSHFGDKQDKKIAPETHRSKEV
PLNEKVCLQVGSQCSTSESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSNMKCSWLP
GRNTSPDTNYTLYYWHSSLGKILQCENIYREGQHIGCSFDLTKVKDSTAEQHGIQIMVKD
NAGKIRPSFNVVPLASHVKPDPPHIKNLFFQNDNLHVQWENPRNFTSRCLYYEVEVNNSQ
SETCDIFYVEEAKCQDSEFERNTEDTICFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWS
NWSQAMSIGKEPNSTFYITMLLIIPVIVTGAIIILLLYLKRLKIIIFPPIPDPGKIFKEM
FGDQNDDTLHWKKYDIYEKQIKEETDSVVLIENLKKASQ
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggtcgaggaagtttgggtgggtcgtggacggggttcaggagcgccagccggcggcggt
ggcgcagccccgaggtcaggtgtggcgccgcaggagccgccggcgccccgcctctccgcc
cccgcgcgccggctcgggttacctgcggccggtgggcggggccgccttcccgtctgcgcc
ggccctcagcctccagggaggctgagccgggaagtgggagagggagcggaggaggcggag
actgccgaggttccagcccggccgggctccgaggcgaggggctgcatggagcggccggct
tggttctgcgggctgttggcactgttgctctgcgccagcggcagcggggacgccgcgccc
acagaaactcagccacctgtgacgaatttgagtgtctctgttgaaaatctgtgcacaata
atatggacatggaatccacctgagggagccagcccaaattgtagtctacggtattttagt
cactttggtgacaaacaggataagaaaattgctccagaaactcatcgttcaaaagaagta
cccttaaatgagaaggtttgtctgcaagtgggatcccagtgtagcaccagtgaaagtgag
aagcctagcattttggtggaaaagtgcatttcacctcctgaaggtgatcctgagtctgct
gtgactgagctccaatgcatttggcacaacctgagcaacatgaaatgctcttggctccct
ggaaggaatacaagtcctgacactaactacactctctactattggcacagcagcttggga
aaaattcttcaatgtgaaaacatctatagagaaggtcaacacattggttgttcatttgat
ctgactaaagtgaaggattctactgctgaacaacatggtatccaaataatggtcaaggat
aatgcaggaaaaattagaccatctttcaacgtagtgcctttagcttcccatgtgaaacct
gatcctccacatattaaaaatctcttcttccaaaatgataacttacatgtgcagtgggag
aatccacggaattttactagcagatgcttatattatgaagttgaagtcaataacagtcaa
tctgagacatgtgatattttctatgttgaagaggccaaatgtcaggattcagaatttgaa
agaaacacggaggatacaatttgtttcatggtccctggtgttcttcctgatactttgaat
acagtcagaataagagtcaaaacaaataagttatgctatgaggatgacaaactctggagt
aattggagtcaagcaatgagtataggaaaggagcccaattctacattctatataaccatg
ttactcatcattcctgtcatcgtcacaggtgcaatcataatccttctgctttatctaaaa
cggctcaagatcattatatttcctccaattcctgatcctggcaagatttttaaagaaatg
tttggagaccagaatgatgatactctgcactggaagaagtatgacatctatgagaagcaa
atcaaagaagaaaccgactctgtggtgctgatagaaaatctgaagaaagcctctcagtga

DBGET integrated database retrieval system