KEGG   Oryctolagus cuniculus (rabbit): 100351936
Entry
100351936         CDS       T03373                                 
Symbol
ENAH
Name
(RefSeq) enabled homolog (Drosophila)
  KO
K05746  enabled
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04360  Axon guidance
ocu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100351936 (ENAH)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100351936 (ENAH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100351936 (ENAH)
SSDB
Motif
Pfam: WH1 VASP_tetra Ran_BP1
Other DBs
NCBI-GeneID: 100351936
NCBI-ProteinID: XP_017203092
LinkDB
Position
16:complement(47468050..47624010)
AA seq 806 aa
MFAGDSLSTCEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRK
IQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLN
SQETAQSKVTATQDSTNLRCIFCGPTLPRQNSQLPAQVQNGPSQEEMEIQRRQLQEQQRQ
KELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERERLERLE
RERQDQLEREQLEWERERERRVSSAAPSPDSSLYSAPLPEYSSCQPPSAPPPSYAKVISA
PVSEATPDYAVVTALPPTSTPPTPPLRHSATRFATSLGSAFHPVLPHYATVPRPVNKNSR
PSSPVNTPSSQPPATKPCAWSTSNFSPLPPSPPIMISSPPGKATGPRPVLPVCVSSPVPQ
MPPSPTAPNGLLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPLPSLASLSHCGSQASPPPS
TPIASTPSSKPSVLPSPSAAGPASVETPLNSVLGDSSASEPGLQAASQPAETPAQQGIVL
GPPAPPPPPPLPSGPAQAALPPPPGPPPPPPLPSSGPPPPPPPPPLPNQVPPPPPPPPAP
PLPASGFFSGSMSEDNRPLTGLAAAIAGAKLRKVSRVEDASFPSGGNTIGVNSVSSKTDT
GRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTVETEQKEDKSEDSEPVTSKASSTSTP
EMVFPLHRRDSPRKNQIVFDNRSCDSLHRPKSAPSSQPSANGVQTEGLDYDRLKQDILDE
MRKELTKLKEELIDAIRQELSKANTA
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgtttgctggggactcattatctacatgtgaacagagtatctgtcaggcaagagctgct
gtgatggtttatgatgatgccaataagaagtgggtgccagctggtggctcgactgggttt
agcagagttcacatctatcaccatacgggcaacaacacattcagagtggtgggcaggaag
attcaggaccatcaggttgtgataaattgtgccattcctaaagggttgaagtacaatcaa
gctacacagaccttccaccagtggcgagatgctagacaggtgtatggtctcaactttggc
agcaaagaggatgccaatgtcttcgcaagtgccatgatgcatgccttagaagtattaaat
tcacaagaaacagcccagagcaaggttactgctacccaggacagcactaatttgcgatgt
attttctgtgggccaacattgcctagacaaaattcacaactacctgcccaagttcagaat
ggcccatcccaagaagaaatggaaattcaaagaaggcaactacaggagcagcaaagacaa
aaggagctggagcgggaaaggctggagagagaaagaatggagcgggaaaggttggagaga
gagaggttagaaagagaaaggctggagagggagcgactagagcaagaacagctggagaga
gagagacaggagcgggagcggcaggagcggctggagcgggagcggctggagcggctggag
cgggagcggcaggaccagttagagagggagcagctggagtgggagcgcgagcgcgagcgc
agagtctccagtgctgctccatctccagacagctccctgtatagcgctccacttcctgag
tattccagttgccagcctccttcggcacctcctccatcatatgctaaagtcatctcagct
ccagtgtcagaggccactcctgattatgccgtagtgactgctttgccacctacttccaca
ccccctacaccaccactgcgacactcagcgacacgttttgcaacatctttaggttcagcc
ttccaccccgttcttccccattatgctacagttcctcgtcctgtgaacaaaaactctcga
ccttcttctcctgtgaacacaccctcttctcagcctccggctacgaagccctgtgcctgg
tctacttccaatttttcgcccctccctccatctcctccaataatgattagcagcccccca
ggcaaagctactggtccaaggcctgtcctccctgtttgtgtttcttctcctgtgccccaa
atgcctccatcaccgacagctcccaatgggctgcttgactctgttacatatccagtgtct
ccaccgcctacctcagggccagcagctccgccgccaccgccaccgccgccgccgccgccg
ccactgccttccctcgcatcactctcacactgtggatctcaagcttctcctcctccaagc
acccctattgcctcaactccctcatccaagcctagtgttctcccttctccctctgcagct
ggccctgcctctgttgagactcctctaaactctgtgctgggagactcctctgcttctgag
ccaggcttgcaggcagcctctcagccggccgagactccagcccaacagggcattgtcttg
ggaccacctgcaccaccccctcctccccccctcccatcaggtcctgcccaggcagcgctc
cctcctccccctggaccccctcctccccctccactgccttcctctgggcctccaccacca
cctccccctccccctcttcctaatcaagtaccccctcctccaccaccacctcctgcccct
cccctccctgcatctggatttttttccggatccatgtcagaagacaatcgacctttaact
ggacttgcagctgcaattgctggagctaaacttaggaaagtgtcacgggtggaggatgcc
tccttccccagtggagggaataccattggtgtgaactcagtgtcatctaaaacagatacg
ggtcgtggaaatggaccccttcctttagggggtagtggtttaatggaagaaatgagtgcc
ctgctggccaggaggagaagaattgctgaaaagggatcaacagtagaaacagaacagaaa
gaagacaaaagtgaagattcagagcctgtaacttctaaggcctcttcaacaagcacaccc
gaaatggtttttccccttcatagacgggattctccaaggaaaaatcagattgtttttgac
aacaggtcctgtgattcattacacagaccaaaatctgcaccctcatcacagcccagtgcc
aatggagtccagacagaaggacttgactatgacagactgaagcaggatattttagatgaa
atgagaaaagaattaacaaagctaaaagaagagctcattgatgcaatcaggcaggaactg
agcaaggcgaatactgcatag

DBGET integrated database retrieval system