KEGG   Oryctolagus cuniculus (rabbit): 100352012
Entry
100352012         CDS       T03373                                 
Symbol
VTA1
Name
(RefSeq) vesicle trafficking 1
  KO
K12199  vacuolar protein sorting-associated protein VTA1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352012 (VTA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352012 (VTA1)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    100352012 (VTA1)
SSDB
Motif
Pfam: Vta1 Vta1_C
Other DBs
NCBI-GeneID: 100352012
NCBI-ProteinID: XP_002714896
Ensembl: ENSOCUG00000002554
LinkDB
Position
12:132668017..132776833
AA seq 307 aa
MAALAPLPPLPPQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFL
SKLMDQLEALKKQLGDNEAITQEIVGSAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
ASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDGEENED
AGVASLPTQPPQPSSSSAFDPGSMPSGSYSGIQIPPGAHAPANTPAEVPHGTGVTSNTIQ
PAPQTIPAIDPALFSTVSQGDIRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALK
LLTTGRE
NT seq 924 nt   +upstreamnt  +downstreamnt
atggctgcgctggctccgctgcccccgctccccccacagtttaagagcatacagcatcac
ctgaggacggctcaggagcatgacaagcgggacccggtggtggcctattactgtcggtta
tatgccatgcaaactggaatgaagattgatagtaaaactcctgaatgtcgtaaattttta
tcaaaattaatggatcagttagaagctcttaagaaacagttgggtgataatgaagctatt
actcaagaaatagttggctctgcccatttggagaattatgctttgaaaatgtttttatat
gcagacaatgaagatcgtgctgggcgatttcacaaaaacatgatcaagtccttctatact
gcaagtcttttaatagatgtcataacagtgtttggagaactcactgatgaaaatgtgaaa
cacagaaagtatgcaaggtggaaggcaacatatatccataattgcttaaagaatggggag
actcctcaagcaggccctgttggaattgaagaagataatgatggtgaagaaaatgaagat
gccggagtagcctctttgcccactcaaccacctcagccatcatcatcctcagcatttgac
ccaggcagcatgccatcaggcagctatagtggcatacagattcctccgggtgcacacgct
ccagccaacacaccagcggaagtgcctcatggcacaggtgtaacaagtaatactatccaa
cctgctccacagactattccagccattgatcctgcacttttcagtacagtttcccagggc
gatatccgcctcacccctgaggactttgcgagagctcagaagtactgcaaatatgccggc
agtgctttgcaatatgaagatgtaagcactgccgttcagaatctacagaaagccctcaag
ttactgacgaccggcagagaatga

DBGET integrated database retrieval system