KEGG   Oryctolagus cuniculus (rabbit): 100352065
Entry
100352065         CDS       T03373                                 
Symbol
IL23A
Name
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05133  Pertussis
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100352065 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352065 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100352065 (IL23A)
   04659 Th17 cell differentiation
    100352065 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352065 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100352065 (IL23A)
   05152 Tuberculosis
    100352065 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100352065 (IL23A)
   05321 Inflammatory bowel disease
    100352065 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100352065 (IL23A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100352065 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 100352065
NCBI-ProteinID: XP_002711125
Ensembl: ENSOCUG00000007233
UniProt: G1SSM0
LinkDB
Position
4:39913110..39916509
AA seq 191 aa
MLGLKAGLLLLLLLWTAQGRAVPGDSSPAWTQCQQLSQKLCTLAWSAHPQMGPMELLREE
GDEETTSDDVPHIQCEDGCDPQGLRDNTQFCLQRIRQGLFFYEKLLGSDIFTGEPALLPD
GPVGQLHASLLGLSQLLQPEGHHRETPQTPSLHPSQPWQRRLLRFKILRSLQAFLAVAAR
VFAHGAATLSP
NT seq 576 nt   +upstreamnt  +downstreamnt
atgctggggctcaaagctgggttgctgctgttgctgctgctctggactgctcagggccgg
gctgtgcctggggacagcagccccgcctggactcagtgccagcagctctcccagaagctc
tgcacactggcctggagtgcacatccccagatgggacccatggagctactaagagaagag
ggagatgaagagactaccagtgacgatgtcccccatatccagtgtgaagatggctgtgac
ccccagggactaagggacaacactcagttctgcctgcagaggatccgccagggtttgttt
ttttacgagaagctgttgggctcagacattttcacaggggagccggctctcctccctgac
ggccctgtgggtcagcttcacgcctctctcctgggcctcagccaactcctgcagcccgag
ggtcaccaccgggagactccgcagaccccgagcctccatcccagccagccatggcagcgc
cgcctcctccgcttcaagatccttcgcagcctccaggcctttttggccgtggctgcccga
gtctttgcccatggagcggcaactctgagcccctaa

DBGET integrated database retrieval system