KEGG   Oryctolagus cuniculus (rabbit): 100352108
Entry
100352108         CDS       T03373                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352108 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100352108 (TNFRSF8)
   04090 CD molecules [BR:ocu04090]
    100352108 (TNFRSF8)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100352108 (TNFRSF8)
CD molecules [BR:ocu04090]
 Proteins
  100352108 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100352108
NCBI-ProteinID: XP_017193061
Ensembl: ENSOCUG00000015925
LinkDB
Position
Un
AA seq 620 aa
MTVKDRRVARAPVLGLLSSCPHRLTPGPLAARPFLRGHPASAVPAAHNALPPVQAFLAAR
DRALKDACARDPGRYYDKAAGQCCYRCPSGLSPTQPCPQGSADCRKQCEPDYYLNRDGRC
TACVSCSTDDLVEKRPCSWNSSRVCECRPGMFCATSAANSCARCQARPACPPGMASRFPG
TAKDAECEPPSPATSPACSSPEDCKAPPRGTAPQAKPSLRSPATSSTRTTLLTGATPPTP
EDASRPPRTDPPSTMANLGIDPDPGSSPTPTQLCPQGSPSCRKQCQPDHYLDANGRCMAC
VSCLRDDLVEKRPCSWNSSRVCECRPGMFCATSAANSCARCQARPACPPGMAIDPQEIPA
ESDATPEPPPPGTLPDCSSPEDSGAPASTATLSSQLDPHTRSSSTPGSSSSTRKPTLDPG
PVLFCVILVLVAALGSGSFLLCHRRACRKRIWQKLHRCYSAQTFRPAVERADSRRWRNPE
SSSTVVAELGPEPAVETCPLVGTALVEDLPLLNASPAGGPSPSWELPEPRVSTEHTNNKI
EKIYIMKADTVIVGTVKAEVPEGWGVAGPTEPQSEELEVDHAPHYPEQETEPPLGSCGDV
TFSVEEEGKEDPLPSSASGK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgacagtaaaggacaggcgtgtcgccagggccccagtactgggcctcctgtcctcctgc
ccgcaccgtctgacccccggacccctggcggcccggcccttcctgcgggggcaccctgct
tcggccgtgcctgctgcccacaacgcgcttcccccagtccaagccttcttggcggccagg
gatcgcgccctcaaggacgcctgtgccagagaccccggacgctactacgacaaggctgcc
ggccagtgctgctaccgctgcccctcagggctgtcacccacgcagccgtgcccgcagggg
tctgccgactgcaggaagcagtgcgagcccgattactacctgaacagggacggccgctgc
accgcctgcgtgagctgctctacagacgaccttgtggagaagaggccgtgctcctggaac
tcctcccgcgtctgcgagtgtcggccgggcatgttctgcgccacctccgcggccaactcg
tgcgcccgctgccaggcccgccccgcctgccccccagggatggccagcaggttcccaggc
acagccaaggacgccgagtgtgagccgccttccccggccaccagccctgcctgtagcagc
ccggaggactgcaaggcgccccccaggggcaccgctccccaggccaagcccagcctgagg
tccccagccacctccagtaccaggaccacgctcctcacgggggccacccctcccacccca
gaggatgcttctagaccaccgaggaccgaccctccctccaccatggccaacctgggcata
gacccagacccagggtcgtccccgacgccgacacagctgtgcccgcaggggtctcccagc
tgcaggaagcagtgccagccagaccactacctggacgcgaacggccgctgcatggcctgt
gtgagctgcttgcgtgacgaccttgtggagaagagaccgtgctcctggaactcctcccgc
gtctgcgagtgtcggccgggcatgttctgcgccacctccgcagccaactcgtgcgcccgc
tgccaggcccgccccgcctgccccccggggatggccatcgacccccaggaaattcccgct
gagagcgacgccacccctgagccgcctcccccggggaccctccctgactgcagctccccc
gaggacagtggggcgcctgccagcaccgccacgctcagctcccagctggacccccacacc
cgctcctccagcacccccggctcctcctcctccacccggaagcccacgctggatccaggc
cccgtgctcttctgcgtgatcttggtgctggtggcggctctgggctccggctccttcctc
ctgtgccaccggagggcctgcaggaagcggatctggcagaagctgcaccggtgctactcg
gcccagaccttccggcctgcggtggagcgagcggattccagacgatggaggaacccagaa
tcgagcagcaccgtggtggcggagctgggcccagagccggccgtggagacctgccccctc
gtgggcaccgccctcgtggaggacctcccgctgctgaacgccagcccggccgggggcccc
tcaccctcatgggagctgcctgagccccgagtgtccacggagcacaccaataacaagatc
gagaaaatctatatcatgaaggccgacacggtgatcgtggggactgtgaaggccgaggtg
cccgagggctggggcgtggcagggcccacagagccccagtcggaggagctggaggtggac
catgccccccactacccggagcaggagacagaacctcccctgggcagctgtggagatgtc
acgttctcagtggaggaggaagggaaggaggaccccctgcccagcagcgcctctggaaag
tga

DBGET integrated database retrieval system