KEGG   Oryctolagus cuniculus (rabbit): 100352323
Entry
100352323         CDS       T03373                                 
Symbol
IST1
Name
(RefSeq) IST1, ESCRT-III associated factor
  KO
K19476  vacuolar protein sorting-associated protein IST1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352323 (IST1)
SSDB
Motif
Pfam: Ist1
Other DBs
NCBI-GeneID: 100352323
NCBI-ProteinID: XP_008255782
Ensembl: ENSOCUG00000009022
LinkDB
Position
5:complement(27626319..27651345)
AA seq 354 aa
MLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHII
REDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLAESVSTLIWAAPRLQSEVAELKIV
ADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
SVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGGGGGGFTTPVGGPDGTVPMPMPMPMPM
PSPNPPFSYPLPKGPSDFNGLPVGTYQAFPNIHPPQIPATPPSYESIAGPRPKPEPSAKP
PARPVENYDNFVLPELPSVPDTLPAASAGANSSASEDIDFDDLSRRFEELKKKT
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgggttctggatttaaagctgagcgtttacgagtcaatttgagattagtcataaat
cgtctgaaactattggagaaaaaaaaaacggaactggcccagaaagcgaggaaggagatc
gctgactacctggctgctgggaaggatgagcgagcccggatccgcgtggagcacataatc
cgggaagactacctggtggaggccatggagatcctggagctgtactgtgacctgctgctg
gcacggtttggcctcatccagtccatgaaggagcttgatcctggtctggcagaatctgtg
tccacactgatctgggctgctcctcgactccagtcagaagtggctgagttgaaaatagtt
gctgatcagctctgtgccaagtatagcaaggaatacggcaagttgtgcaggaccaaccag
atcggcactgtgaacgaccggctgatgcacaaactgagtgtggaggcccctcccaaaatc
ctggtggagaggtacctcattgagatcgccaagaattacaatgttccctacgagcctgac
tctgtggtcatggcagaagctcctcctggggtagagacagatcttattgatgttggattt
acagatgatgtgaagaaaggtggccctggaagaggaggaggaggagggggtgggttcacc
acaccagttggtggacctgatggaacagtgccaatgcccatgcccatgcccatgcccatg
ccatctccaaatcctcctttctcatatccactgccaaagggaccttcggatttcaatgga
ctgcctgtggggacttatcaggcctttcccaatattcatccacctcagataccagcaact
cctccgtcgtatgaatctatcgcaggtcccagacctaagccagagccctctgcaaagccc
cctgctagaccagtggagaactatgacaacttcgtgctcccagagttgccatccgtgcca
gacacactacccgctgcctctgctggtgccaactcctcagcatcggaagacatcgacttc
gatgatctttcccggagatttgaagagctgaaaaagaaaacatag

DBGET integrated database retrieval system