KEGG   Oryctolagus cuniculus (rabbit): 100352519
Entry
100352519         CDS       T03373                                 
Symbol
ANAPC13
Name
(RefSeq) anaphase promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100352519 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352519 (ANAPC13)
   04114 Oocyte meiosis
    100352519 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100352519 (ANAPC13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352519 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100352519 (ANAPC13)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100352519 (ANAPC13)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100352519 (ANAPC13)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100352519 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 100352519
NCBI-ProteinID: XP_002716344
LinkDB
Position
14:complement(28403993..28411282)
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPVGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggtgcagcgggatggaaggatcttggatctcatcgacgacgcttggcgg
gaagacaagctgccttacgaggatgtggcgataccgctgaacgagctgcctgaacccgag
caggacaacggcggcaccacggagtctgtcaaagaacaagaaatgaagtggacagacctg
gccctgcagtacctgcacgagaacgtgccccccgtcgggaactga

DBGET integrated database retrieval system