KEGG   Oryctolagus cuniculus (rabbit): 100352521
Entry
100352521         CDS       T03373                                 
Symbol
ACKR4
Name
(RefSeq) atypical chemokine receptor 4
  KO
K04186  atypical chemokine receptor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352521 (ACKR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100352521 (ACKR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100352521 (ACKR4)
   04050 Cytokine receptors [BR:ocu04050]
    100352521 (ACKR4)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100352521 (ACKR4)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100352521 (ACKR4)
SSDB
Motif
Pfam: 7tm_1 DUF621 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100352521
NCBI-ProteinID: XP_002716461
Ensembl: ENSOCUG00000016560
UniProt: G1TBW3
LinkDB
Position
14:27461947..27467802
AA seq 350 aa
MALEQNQSTDYYYEENELNGTHDYSLYEAICIKEEVRQFAKVFLPVFFTITFITGLAGNS
TVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKVMCKVTSALYT
VNFVSGMQFLACISIDRYWAVTKVPGPAGAGRPCWLICLCVWLAATLLSSPQLVFYTVND
NARCIPVFPHQLGTSVKASVQMLEICIGFVIPFLIMGVCYFITARTLIKTPNIKKSRPLK
VVLAVVLVFIVTQLPYNVVKFCQAVDIIYSLITDCDASKRLDVAIQVTESIALFHSCLNP
ILYVFMGASFKNYIMKVAKKYGSWRRQRQNAEEIPFDSEGPTEPTSTFSI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcgttggagcagaaccagtcaacagattactactacgaggagaatgagctgaatggc
acgcacgactacagcctgtacgaagctatctgcataaaggaagaggtgagacagtttgca
aaagttttcctccctgtcttcttcaccatcactttcatcactggacttgctggcaactcc
accgtagtggccatctatgcctattacaagaaacagcgcaccaaaaccgatgtgtacatc
ttgaacttggccgtggctgatttactcctgctgtttaccctacctttctgggcagtcaat
gcggttcacgggtgggttctaggtaaagtgatgtgcaaggtgacgtcggccttgtacaca
gtcaactttgtctcaggaatgcagttcctggcttgtatcagcatcgacagatattgggca
gtaaccaaagtccccggcccagcgggggcgggaaggccgtgctggctcatctgtctctgc
gtctggctggccgctaccttgctgagcagcccccagctggtgttttacacggtcaacgac
aatgcccgctgcatccccgtctttccccaccagctgggaacctcggtgaaagcatcggtc
cagatgctggagatctgcatcgggttcgtgataccctttctcatcatgggggtgtgttac
ttcattacggcaagaacgctcatcaagacgccgaacattaagaaatcccgacccctcaaa
gttgtgctcgccgtggttctagttttcatcgtaacgcagctgccttacaacgtcgtcaag
ttctgccaagccgtggacatcatctactccctgatcaccgactgcgacgccagcaagcgc
ctggacgtcgccatccaggtcaccgagagcattgcgctcttccacagctgcctcaacccc
atcctctacgtcttcatgggcgcctcttttaaaaactacatcatgaaagtggccaagaaa
tacgggtcctggagaagacagcgacaaaacgcagaggagattcctttcgattccgagggc
cctacagagccgaccagtaccttcagcatttaa

DBGET integrated database retrieval system