KEGG   Oryctolagus cuniculus (rabbit): 100352532
Entry
100352532         CDS       T03373                                 
Symbol
GFAP
Name
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100352532 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352532 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100352532 (GFAP)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100352532 (GFAP)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     100352532 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 GAS
Other DBs
NCBI-GeneID: 100352532
NCBI-ProteinID: XP_017204733
Ensembl: ENSOCUG00000006895
LinkDB
Position
19:45399899..45408683
AA seq 473 aa
MERRRIASVARRSYTSSAEMVLGGSAPGRRLGPGARLSLARTSVPLPARVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTASSTRLEVERDNLAQDLGTLRQKLQDETELRMEAENNLTTYRQEADEAT
LARLDLERKIESLEEEIQFLRKVHEEEVRELQEQLAQQQVHVELDVAKPDLTAALREIRT
QYEAVASSNMHEAEEWYRSKFADLTDAAARNAELLRQTKHEANDYRRQLQALTCDLESLR
GTNESLERQMREQEERHAREAAGYQEALARLEEEGRSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSSKEGESHKVTRHLKSLTVQVVPIQAH
QQIVNGAPPALETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggagcggagacgcatcgcctctgttgctcgccgctcttacacctcctctgccgagatg
gtgctggggggctcagcgcccgggcgccgcctggggcccggcgcccgcctctccctggcc
cgaacatctgttccactcccggcccgggtggacttctcgctggccggcgcactcaatgcc
ggcttcaaggagacccgggccagtgagcgagccgagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggagcagcaaaacaaggcgctggccgccgag
ctcaaccagctgcgggccaaggagcccaccaagttggccgacgtctaccaggctgagctg
cgggagctgcggctgcggctcgaccagctcacggccagcagcacccggctggaggtggag
agggacaatctggcgcaggacctgggcaccctgaggcagaagctccaggatgagactgaa
ctgaggatggaggctgagaacaacctgaccacctacagacaggaggcggatgaagccacc
ctggcccgcctggatctggagaggaagattgagtccctggaggaggagatccagttcttg
aggaaggtccacgaggaggaggtgcgggaactccaggagcagctggcccaacagcaggtg
cacgtggagctggatgtggccaagcccgacctcacagcagccctgagagagatccgcacg
cagtacgaggcagtggcgtccagcaacatgcacgaggccgaggagtggtaccgctccaag
tttgcagacctgaccgatgccgctgcccgcaacgcggagctgctccgccagaccaagcac
gaggccaacgactacaggcgccagctgcaggccctgacctgcgacctggagtccctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcgccacgcgcgggag
gcggcgggctaccaggaggcgctggcccggctggaggaggaggggcggagcctcaaggac
gagatggcccgccacctgcaagagtaccaggacctgctcaacgtgaagctggccctggac
atcgagatcgccacctacaggaagctgctggagggcgaagagaaccgcatcaccatcccg
gtgcagaccttctccaacctgcagatccgagggggcaaaagcagcaaagaaggggaaagt
cacaaggtcaccagacatctcaaaagcctcacagtacaagttgtcccaatacaggctcac
cagcagattgtaaacggagccccgccggcgctcgagaccagcctggacaccaagtccgtg
tcagaaggccacctcaaaaggaacatcgtggtgaagaccgtggagatgcgggacggcgag
gtcattaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system