KEGG   Oryctolagus cuniculus (rabbit): 100352594
Entry
100352594         CDS       T03373                                 

Symbol
JAK1
Name
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04621  NOD-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05212  Pancreatic cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100352594 (JAK1)
   04151 PI3K-Akt signaling pathway
    100352594 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100352594 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100352594 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100352594 (JAK1)
   04658 Th1 and Th2 cell differentiation
    100352594 (JAK1)
   04659 Th17 cell differentiation
    100352594 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352594 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352594 (JAK1)
   05203 Viral carcinogenesis
    100352594 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100352594 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100352594 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352594 (JAK1)
   05161 Hepatitis B
    100352594 (JAK1)
   05160 Hepatitis C
    100352594 (JAK1)
   05171 Coronavirus disease - COVID-19
    100352594 (JAK1)
   05164 Influenza A
    100352594 (JAK1)
   05162 Measles
    100352594 (JAK1)
   05168 Herpes simplex virus 1 infection
    100352594 (JAK1)
   05163 Human cytomegalovirus infection
    100352594 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100352594 (JAK1)
   05169 Epstein-Barr virus infection
    100352594 (JAK1)
   05165 Human papillomavirus infection
    100352594 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100352594 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100352594 (JAK1)
   05140 Leishmaniasis
    100352594 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100352594 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352594 (JAK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100352594 (JAK1)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100352594 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 RIO1 TCAD9
Other DBs
NCBI-GeneID: 100352594
NCBI-ProteinID: XP_008263345
Ensembl: ENSOCUG00000006227
UniProt: G1SQL4
LinkDB
Position
13
AA seq 1151 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVDLEAPEPGVEVVFYLSDREPLRLGSGEYTAEEV
CIRAAQECRISPLCHNLFALYDESTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DSEQSVWRHSPKKQKNGYEKKKVPDATPLLDANSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMRKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSSDSGIVLYYEVMVTGNLGIQWRQKPNVVPVEKEKSKLKRKKLENKLRKDEERNKTR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGNEEGMYVLRWSCTDFDNILMTVT
CFEKSERQFKNFQIEVRKGCYSLHGSDRSFPSLGELMSHLKKQILRTDNISFVLKRCCQP
KPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYAGTLVDHK
DDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMV
EEFVEGGPLDLFMHRKSDLLTTPWKFKVAKQLASALSYLEDKDMVHGNVCTKNLLLAREG
IDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEI
CYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDIN
KLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVA
VKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKE
YLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTK
AIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSEYSPMA
LFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDQVYQLMRKCWEFQPSNRTTFQNLI
EGFEAILKKHE
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagaccgaggtggatctggaggcccctgagcctggggtggaagtggtcttc
tatctgtcggacagggaacccctccggctgggcagtggagagtacacggcggaggaggtg
tgcatcagggccgcacaggaatgccgtatctctcctctgtgtcacaacctctttgccttg
tatgatgagagcaccaagctctggtatgctccgaatcgcaccatcactgttgatgacaag
acgtccctccggctgcactaccggatgaggttctatttcaccaactggcatgggaccaat
gacagcgagcagtctgtgtggcgacattctccaaagaagcagaaaaatggctatgagaaa
aagaaggttccagatgcaacccctctccttgacgccaactccctggagtatctgtttgct
cagggacaatatgatttggtcaaatgcctggctcctattcgagaccccaagacggaacag
gatgggcatgacatcgagaatgagtgtctagggatggccgtcctggccatctcacactat
gccatgatgaggaaaatgcaattgcctgaactccccaaggacatcagctataagcgatat
atcccagaaacgttgaataagtccatcagacagaggaaccttctcaccaggatgcggatt
aataatgttttcaaggatttcctaaaggagtttaacaacaagaccatttgtgacagcagc
gtgtcaacacatgacctgaaagtgaaataccttgctactttggagactttgacaaaacat
tatggtgctgaaatatttgagacttccatgttactgatctcatcagaaaatgagatgaat
tggtttcattccagtgacagtggaattgttctctactatgaagtgatggtgactggaaat
cttggaatccagtggaggcagaaaccaaatgttgtgcctgttgaaaaagaaaaaagtaaa
ctgaagcggaagaaactggaaaataaactcaggaaagatgaggagagaaacaaaacgcga
gaagagtggaacaatttttcctacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggataacaaaaaaatggaactgaagctctcttcccatgag
gaggccttgtccttcgtgtccctggtggatggctacttccggctcacagcagatgcccat
cattacctctgcactgacgtggctccaccactgatcgtccacaacatacagaatggctgt
catggtccaatctgcacagagtatgccatcaataaactgcggcaagaagggaatgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgactgtcacc
tgctttgagaagtctgagagacagttcaagaactttcagatcgaggtgcggaagggctgc
tacagcctgcacggctcagaccgcagcttccccagcctgggagaactcatgagccacctc
aagaagcagatcctgcgtacagacaacatcagcttcgtgctgaaacgctgctgccagccc
aagcccagagagatctctaacctgctggtggctactaagaaagcccaggagtggcagcct
gtctatcccatgagccagctgagttttgaccggatcctcaagaaagatatcatgcagggc
gagcacctggggagaggcaccagaacccatatctacgccgggaccctggtggatcacaag
gatgacgaagggacttcagaagagaagagaataaaagtgatcctcaaagtcttagacccc
agccacagggacatctctctggccttctttgaggcagccagcatgatgagacaggtctcc
cacaagcacatcgtgtacctctatggtgtctgtgtccgcgacgtggagaatatcatggtg
gaagagtttgtggaaggagggcccctcgatctcttcatgcaccggaaaagcgacctgctc
acgacgccgtggaagttcaaagttgccaagcagctggccagcgccctgagttacctggag
gacaaggacatggtccacgggaacgtgtgcaccaagaacctactgctagcgcgcgagggc
atcgacagcgagtgcgggccgttcatcaagctcagcgaccccggcatccccatcaccgtg
ctgtcccggcaggagtgcatagaacgcatcccgtggattgctcccgagtgtgtggaagac
tccaagaacctgagcgtggctgctgacaagtggagcttcggaaccacgctctgggagatc
tgctacaatggcgagatccccctcaaagacaagacactcatcgagaaagagagattctac
gagagccgctgccggccagtgaccccgtcctgtaaggagctggcggaccttatgacccgc
tgcatgaactacgaccccaaccagagacccttcttccgcgccatcatgagagacatcaac
aagctggaagagcagaatccagacatcgtgtcggagaggaagccagccactgaggtggac
cccacgcattttgaaaagcgcttcctcaagaggatccgggacttgggcgagggccacttt
gggaaggttgagctctgcaggtatgaccccgagggggacaacacgggggagcaggtggct
gtgaagtccctaaagccagagagcggcggtaaccacatagctgacctcaagaaggaaata
gaaatcttgcggaacctctatcacgagaacatcgtgaagtacaaagggatctgcaccgag
gacggaggaaacggtattaagctcatcatggaatttctgccttcgggaagccttaaggag
tatcttccaaagaataaaaacaaaattaatctcaagcaacagctaaaatatgccgtgcag
atttgtaaggggatggactatttgggttctcggcagtacgtccaccgggacttagcagca
agaaatgtccttgttgagagtgaacaccaagtgaaaattggagacttcggcttaaccaaa
gcgatcgagacagacaaggagtactacaccgtcaaggacgaccgggacagccctgtgttt
tggtatgccccagaatgtttaattcagtgtaaattctatattgcctccgacgtctggtcc
tttggagtgactctgcacgagctactcacttactgtgattcagaatatagtcccatggcc
ttgttcctgaaaatgataggcccaactcatggccagatgacagtaacaagacttgtgaat
acactgaaggaaggaaaacgtttgccgtgtccacccaactgtccagatcaggtttatcaa
cttatgaggaaatgctgggaattccaaccttccaatcggacaacctttcagaaccttatt
gaaggattcgaagcaattttaaaaaagcatgaataa

DBGET integrated database retrieval system