KEGG   Oryctolagus cuniculus (rabbit): 100352661
Entry
100352661         CDS       T03373                                 
Symbol
SMO
Name
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04340  Hedgehog signaling pathway
ocu04360  Axon guidance
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100352661 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100352661 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352661 (SMO)
   05205 Proteoglycans in cancer
    100352661 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100352661 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100352661 (SMO)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100352661 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100352661
NCBI-ProteinID: XP_002712105
LinkDB
Position
7:complement(15366399..15397639)
AA seq 1125 aa
MPVHSPRTAWCPDSLSRGPNADSRASSLNVCPQNADRRREELKELPQSKKASRSWGTGPA
TRRHPRSLPARTRRQVRSPQAAGSDARSAAPSSRRPPRLLLQLRAPISTRVSPLGDPGGG
ERGPRVPPARAPRSAGEADVSAPPPQPPLPPLPPQSLLQPRRAGLARRGRCIPESGASRS
NKGAGESARRARGAAARSGGGGGWAAGWRGAEPGSWCRTPGSRLASPAGPGVDFSGGRRN
GAGERGCRGGPGLKTLWIAGRGRAELCVPARASAAQHGPRVPKLAKLGAEEPGRAERRWG
LGPGLAGRAGRLSRLHGPQSRACGRGAPGLLLSWRVCALAAGRPARGPELLLLGLLLLLG
APGRGAAWSGNATGPGPRGAGGSARRSAAATGPPPLLSRCGRAAHCEPLRYNVCLGSALP
YGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSR
TLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPK
SWYEDVEGCGIQCQNPLYTEAEHQDMHSYIAAFGAITGLCTLFTLATFVADWRNSNRYPA
VILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYA
LMAGVVWFVVLTYAWHASFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGD
SVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASK
INETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPI
PDCEIKNRPSLLVEKINLFAMFGTGISMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIK
KSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTK
MVARRGAILPQDVSVTPVATPVPPEEHANLWLVEAEISPELEKRMGRKKKRRKRKKEVCP
LGPPPELHRPAPAPSTSAVPRLPQLPRHKCLVAAGAWGTGEPSRQGAWTLVSSPFCPESS
LRQDPFLPSVPAPTTWAQGRRQGLGPMHSRTNLMEAELMDADSDF
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgcccgtgcatagcccacggacagcttggtgtccagactctctgagcagaggccccaac
gcggatagcagagcatcgtccttgaacgtgtgtcctcagaatgccgacaggcgcagagag
gagttgaaagagctgccccaaagcaagaaagcctcgcggagctggggaaccgggcccgcc
acccgcaggcatccccggtctctcccagcccgaaccaggagacaagttcgctccccgcag
gctgctggttcggacgcacgatccgcagccccatcatccaggcgcccgccaaggcttttg
ttgcaactccgagccccgatttccacccgcgtctctcccctcggcgacccgggcggcggc
gagcggggtccccgggtccccccagcgcgggcccctcggagcgccggggaagccgacgtt
agcgctcctcctccccagccgcccctcccgcccctcccgccccagtccctcctccagccc
cggcgggcgggcttggctcggcgcggccggtgcattccagagagcggggccagccgaagc
aacaaaggagccggggagtcggcacggagagctcggggggctgcggcgcgctcgggcgga
ggcggtggctgggccgctggctggcgcggggcggagccggggagctggtgccgtaccccc
ggctcgcgcctcgcctcccccgcggggccgggagtcgattttagcggtgggagaaggaat
ggtgctggggaaagggggtgcagggggggcccggggctgaagactttgtggattgccggg
cgagggcgagcggagctgtgtgtccccgcccgggcctccgccgcccaacatgggccccgg
gttccaaagttggcgaagttgggcgccgaggagccggggcgcgcggagcgtcgctggggg
ctcggcccgggactcgcggggcgcgcaggccgcctgagccgcctccacggcccccagagt
cgtgcgtgtggccgaggggcgccggggcttctgctgagttggcgggtttgcgctttggcc
gctggccgccctgcgcgggggccggagctcctgctgctggggctgctgctgctgctgggg
gccccgggccggggggcggcctggagcgggaacgcgacggggcctgggccgcgcggcgcc
ggcgggagcgcgaggaggagcgcggcggccacgggccctcctccgctgctgagccgctgc
ggccgggccgcgcactgcgagccgctgcgctacaacgtgtgcctgggctcggcgctgccc
tacggcgccacctccacgctgctggccggggattccgactcccaggaggaagcgcacggc
aagctggtgctctggtccggcctccggaatgccccccgctgctgggcagtgatccagcct
ctgctgtgtgccgtgtacatgcccaagtgtgagaatgaccgggtggagctgcccagccgc
accctctgccaggccacccggggcccctgcgccatcgtggagagggagcggggctggccc
gacttcctgcgctgcacccctgaccactttccggaaggctgcccgaacgaggtgcagaac
atcaagttcaacagttcgggccagtgcgaagcgcccttggtacggaccgacaaccccaag
agctggtacgaggacgtggagggctgcgggatccagtgtcagaacccgctctacaccgaa
gccgaacaccaggacatgcacagctacatcgccgccttcggcgccatcacaggcctctgc
acgctcttcaccctggccacgtttgtggctgactggcggaactcgaatcgctaccctgct
gtcatcctcttctatgtcaacgcatgtttcttcgtgggcagcatcggctggctggcccag
ttcatggacggggcccgccgggagatcgtctgtcgggcagatggcaccatgaggctgggg
gagcccacctccaatgagaccctgtcctgcgtcatcatctttgtcatcgtgtactatgcc
ctgatggctggcgtggtctggtttgtggtcctcacttacgcctggcacgcctccttcaaa
gcgctgggcaccacctaccagcctctctcgggcaagacctcctacttccacctgctgacg
tggtccctgcccttcgtcctcaccgtggccatccttgctgtggcccaggtggacggggac
tctgtgagcggcatctgtttcgtgggctacaagaactaccgataccgtgccggcttcgtg
ctggcccccatcggcctggtgctgatcgtgggaggctacttcctcatccgaggagtcatg
actttgttctccatcaagagcaaccaccccgggctgctgagcgagaaggcggcgagcaag
atcaacgagaccatgctgcgcctgggcattttcggtttcctggcttttggcttcgtgctc
attaccttcagctgccacttctacgacttcttcaaccaggctgagtgggagcgcagcttc
cgggactatgtgctgtgccaggccaatgtgaccatcgggctgcccaccaagaagcccatc
cccgactgcgagatcaagaatcgccccagcctgctggtggagaagatcaacctgtttgcc
atgttcggaactggcatttccatgagcacctgggtctggaccaaggccaccctgctcatc
tggaggcgcacctggtgcaggctgacggggcagagcgatgacgagcccaagaggatcaag
aagagcaagatgatcgccaaggccttctccaagcgccgcgagctgctgcagaacccgggc
caggagctctctttcagcatgcacaccgtctcccatgacgggcccgtggctggcttggcc
ttcgacctcaacgagccctccgccgacgtctcctccgcctgggcccagcacgtcaccaag
atggtggctcggagaggagccattctgccccaggacgtgtctgtcacgcccgtggcaacg
ccagtgccccctgaggaacacgccaacctgtggctggtggaggccgagatctccccggag
ctggagaagcgcatgggccggaagaagaagcggaggaagcggaagaaggaggtgtgcccg
ctggggccgcccccggagctgcaccggccggcgcccgccccttccaccagcgccgtcccg
cgcctgccgcagctgccccggcacaagtgcctggtggctgcaggtgcctggggcaccggg
gagccctcccgacagggagcctggaccctggtctccagccccttctgcccggagtccagt
ttgcggcaggatccgtttctgcccagcgtgccggcccccacgacctgggctcagggccgc
cgccagggcctggggcccatgcactcccgcaccaacctcatggaggcagagctcatggac
gcagactcggacttctga

DBGET integrated database retrieval system