KEGG   Oryctolagus cuniculus (rabbit): 100352774
Entry
100352774         CDS       T03373                                 
Symbol
SHH
Name
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04340  Hedgehog signaling pathway
ocu04360  Axon guidance
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100352774 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100352774 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352774 (SHH)
   05205 Proteoglycans in cancer
    100352774 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100352774 (SHH)
   05217 Basal cell carcinoma
    100352774 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100352774 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352774 (SHH)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100352774 (SHH)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100352774 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100352774
NCBI-ProteinID: XP_002715068
Ensembl: ENSOCUG00000016862
UniProt: G1TCI1
LinkDB
Position
13:11519897..11532136
AA seq 451 aa
MDEMLLLARCLLVVLVSSLLMCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDSARKVFYVIETLEPRERLLLTAAHLLFVAPHNASAAGEPELAPGAGPPPGG
APGRRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEATGAYAPLTAQGTILIN
RVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDPAAPGAADAPGAPGPAG
IHWYSQLLYQIGTWLLDSEALHPLGMASQSS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggacgagatgctgctgctggcgcggtgtctgctggtggttctggtctcctcgctgctg
atgtgctcggggctggcgtgcggaccaggaaggggatttgggaagaggcggcaccccaaa
aagctgacccctttagcctacaagcagtttatccccaacgtggcggagaagaccctaggg
gccagcggaagatatgaagggaagatctcgagaaactccgagcgatttaaggaactcacc
cccaattacaaccccgacatcatatttaaggatgaggaaaacacaggagcagacaggctg
atgactcagaggtgtaaggacaagttgaacgctctggccatctcagtgatgaaccagtgg
ccgggagtgaagctgcgggtgaccgagggctgggacgaggacggccaccattcggaggag
tcgctgcactacgagggtcgcgctgtggacatcaccacgtctgaccgtgaccgtagcaag
tacggcatgctggcccgcctggctgtggaagccggcttcgactgggtctactatgagtcc
aaagcccacatccactgctcggtgaaagcagagaactcggtggcggccaaatcgggcggc
tgctttcctggctccgccaccgtgcacctggagcagggcggcacgaagctggtgaaagac
ttgcgtcctggggaccgcgtgctggcggccgacgaccagggccggctactctacagcgac
ttcctcaccttcctggatcgcgacgacagcgccagaaaggtcttctacgtgatcgagacg
ctggagccgcgcgagcggctgctgctcaccgccgcgcacctgctgttcgtcgcgccgcac
aacgcctccgccgccggcgagcccgagctggcgccgggcgcagggccgccgccggggggc
gcgccgggccgccgggcgctcttcgccagccgcgtgcgtccgggccagcgcgtgtacgtg
gtggccgagcgcgacggggaccgccgactgctgccagccgccgtgcacagcgtgacgctc
cgcgaggaggccacgggcgcctacgcgccgctcacggcgcagggcaccatcctcatcaac
cgggtgctggcctcgtgctacgcggtcattgaggagcacagctgggcacaccgcgccttc
gcgcccttccgcctggcgcacgcgctcctggccgcgctggcgcccgcgcgcacggaccgc
ggcggggacccggccgcgccaggtgcggccgacgcgccaggtgcgccgggccccgcgggc
atccactggtactcgcagctgctctaccaaatcggcacctggctgttggacagcgaggcg
ctgcaccccctgggcatggcgagccagtccagctga

DBGET integrated database retrieval system