KEGG   Oryctolagus cuniculus (rabbit): 100353137
Entry
100353137         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353137
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353137
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353137
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353137
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353137
NCBI-ProteinID: XP_002708101
Ensembl: ENSOCUG00000021343
UniProt: G1SMG6
LinkDB
Position
1:complement(32312473..32313117)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggaaatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100353640
Entry
100353640         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353640
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353640
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353640
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353640
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353640
NCBI-ProteinID: XP_002708103
Ensembl: ENSOCUG00000022254
UniProt: G1U4J3
LinkDB
Position
1:complement(32334573..32335503)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100353888
Entry
100353888         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353888
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353888
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353888
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353888
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353888
NCBI-ProteinID: XP_002708104
Ensembl: ENSOCUG00000028068
UniProt: G1SMG6
LinkDB
Position
1:complement(32348955..32349566)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354397
Entry
100354397         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354397
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354397
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100354397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354397
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354397
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100354397
NCBI-ProteinID: XP_002708105
Ensembl: ENSOCUG00000021714
UniProt: G1SHV2
LinkDB
Position
1:complement(32363360..32363995)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKHQAVSVLHEMLQQIFNLLHTAHSSAAWNNTLLEELNAALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagcaccaggccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcactcctctgctgcctgg
aacaacaccctcctggaggaactgaatgctgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354910
Entry
100354910         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354910
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354910
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100354910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354910
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354910
SSDB
Motif
Pfam: Interferon DIRP GAT
Other DBs
NCBI-GeneID: 100354910
NCBI-ProteinID: XP_002708107
Ensembl: ENSOCUG00000021872
UniProt: A0A7R8C3N5
LinkDB
Position
1:32419582..32420169
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRKTLVLLGQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQAVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggctcagctgctccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccactgagcaggaagaccttggtgctt
ctgggccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggaagccagttccagaagaaccaggccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaaca
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100355421
Entry
100355421         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355421
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355421
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100355421
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355421
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355421
SSDB
Motif
Pfam: Interferon DIRP GAT
Other DBs
NCBI-GeneID: 100355421
NCBI-ProteinID: XP_002708109
Ensembl: ENSOCUG00000023654
UniProt: G1SI24
LinkDB
Position
1:32438918..32439505
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRKTLVLLGQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaagaccttggtgctt
ctgggccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100356937
Entry
100356937         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356937
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356937
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100356937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356937
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356937
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100356937
NCBI-ProteinID: XP_002708114
UniProt: A0A5F9DR29
LinkDB
Position
1:32526008..32526942
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTAHSSAAWNNILLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcactcctctgctgcctgg
aacaacatcctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100357452
Entry
100357452         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357452
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357452
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100357452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357452
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357452
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100357452
NCBI-ProteinID: XP_002708116
UniProt: A0A7R8C502
LinkDB
Position
1:32544951..32545862
AA seq 195 aa
MAQLLPLLTALVLCSYGLVGSLGCDLPHNSAPLSRSTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccttgttgga
tctctgggctgtgacctgccccacaactctgcccctctgagcaggtcgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100358223
Entry
100358223         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358223
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358223
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100358223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358223
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100358223
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100358223
NCBI-ProteinID: XP_002708119
Ensembl: ENSOCUG00000023921
UniProt: G1U4J3
LinkDB
Position
1:32573601..32574280
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

DBGET integrated database retrieval system