KEGG   Oryctolagus cuniculus (rabbit): 100353223
Entry
100353223         CDS       T03373                                 
Symbol
UBE4A
Name
(RefSeq) ubiquitination factor E4A
  KO
K10596  ubiquitin conjugation factor E4 A [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100353223 (UBE4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100353223 (UBE4A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100353223 (UBE4A)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   100353223 (UBE4A)
SSDB
Motif
Pfam: Ufd2P_core U-box
Other DBs
NCBI-GeneID: 100353223
NCBI-ProteinID: XP_008247658
Ensembl: ENSOCUG00000002397
LinkDB
Position
Un
AA seq 1067 aa
MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDE
FDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMA
VELEDQDWLDMSNVEQAIFARLLLQDPGNHLINMTSSTTLNLSADRDAGERHIFCYLYSC
FQRAKEEITKVPENLLPFAVQCRNLTVSNTRTILLTPEIYVDQNIHEQLVELMLEAIQGA
HFEDVTEFLEEVIQALILDEEVRTFPEVMIPVFDILLGRIKDLELCQILLYAYLDILLYF
TRQKDMAKVFVEYIQPKDPSNGQMYQKTLLGVILNISCLLKTPGVVENHGYFLNPSRSSP
QEIKVQEANIHQFMAQFHEKIYQMLKNLLQLSPETKHCILSWLGNCLHANAGRTKIWANQ
MPEIFLQMHASDAFFLNLGAALLKLCQPFCRPRSSRLLTFNPTYCALKELNDEERRIKNV
HMRGLDKETCLIPAVQEPKFPQNYNLVTENLALTEYTLYLGFHRLHDQMVKINQNLHRLQ
VAWRDAQQSSSPAADSLRDQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAVLLVQLAI
GNEGSQPVELTFPLPDGYNSLAYVPEFFADNLGDFLIFLRRFADDILETSADSLEHVLHF
ITVFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFAHAPQLAE
ALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDNYRESIKDLADYASKNLEAMN
PPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWDGLAPEARREKEAGLQMFG
QLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKD
FSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNM
IVAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMSDPVVLPSSRVTVDRSTIA
RHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQQKEQLE
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgacagaccaggagaataacaacaacatctcaagtaacccctttgctgctctttttggc
tccctggctgatgccaagcagtttgcagcaatccaaaaagagcagctgaagcagcaatct
gatgaactcccagctagcccagatgactcggataatagtgtgtcagagagcctggatgaa
tttgattactctgtggccgagattagtcgctcattccgatcacaacaggaaatatgtgag
caactcaacatcaatcacatgatccaaagaatcttcctcattactctggacaacagtgat
ccaagcttgaaaagtgggaatggtatccccagccgttgtgtgtatttggaagaaatggca
gtagaactggaagatcaagattggcttgatatgagcaatgttgagcaggccatctttgct
cgcctgttacttcaagatccagggaaccacttgattaacatgacttcttccacaacgtta
aatctctctgctgatcgcgatgcaggggagaggcacatattttgttacctgtattcttgc
ttccaaagagccaaggaggagattaccaaagtcccagagaacttgctaccttttgcagtg
cagtgcaggaacctcactgtgtctaatactcggacaattctccttaccccagagatctat
gttgaccaaaacatccatgagcagctggtagagttgatgttggaagccatccaaggagcc
cattttgaagatgtaactgagtttctagaggaggtcattcaagccttgatactggatgaa
gaagttcgaacatttccagaggtcatgattccagtgtttgatattttattgggtcgaatc
aaagatctggagctctgccagatcctattgtatgcatacctggatattcttctctatttc
accaggcaaaaggacatggcaaaggtttttgtagaatacattcagcccaaggaccctagc
aatgggcagatgtaccagaagaccttgctaggagtaattctgaatatttcctgcttatta
aagactccaggtgtggtagaaaatcatggctacttcctgaatccatcccggtccagtcct
caggagatcaaagtccaggaggccaacatccatcagttcatggctcagttccatgaaaag
atctaccagatgctgaagaacttactccagctctctccagaaaccaaacactgtatcttg
tcctggctcggaaactgtttgcatgcaaatgcaggccgcaccaagatttgggccaatcag
atgccagagatcttcctccaaatgcatgcctcggatgccttctttctgaacctgggcgct
gccctcctgaagctgtgccagcctttctgcagacccagatcctctcggctcctcaccttc
aaccccacttactgtgccctcaaggagttgaatgacgaagaacgaagaattaaaaatgta
cacatgagaggtttggacaaagaaacctgtttgatcccagctgtgcaggaaccaaagttt
ccccagaactacaaccttgtgacagagaaccttgccctgacagaatacaccttgtacttg
ggatttcacaggttgcatgatcagatggtcaaaatcaaccaaaacctgcatcggctacag
gtcgcctggcgggatgcccagcaaagctctagccctgctgctgacagtctccgtgatcag
tttgagcggctgatgaccatctatctttctaccaagacggcgatgactgagccacagatg
ctgcaaaattgcctcaatttacaggtgtccatggctgttttgttggttcagctggccata
ggcaacgagggctcacagcctgtagagctgacttttcctttgccagatggctacaactct
ttggcttatgtgccagaattctttgcagataaccttggtgatttcctcattttcctccgc
cgctttgctgatgacatcttggagacatcagcggattccctggagcatgtccttcacttt
atcaccgttttcactggaagcatagaaagaatgaagaatccccatctaagggccaaacta
gctgaggtgttggaagcagtgatgccccatctggaccagaccccaaaccccctggtatcc
agcgtgttccatcggaaacgtgtgttctgcaactttgcacatgcaccccaacttgcagaa
gcgctgatcaaggtttttgtggacattgagttcacaggagaccctcatcagtttgaacag
aagtttaattatcgccgtcccatgtatcccatcctaagatacatgtgggggacagataac
tatcgggagagcattaaggatttggctgactatgcctctaagaatttagaagccatgaat
cccccacttttccttcgctttcttaacctactaatgaacgatgccatcttccttttggat
gaagccatacagtatttaagcaagataaagattcagcagatcgagaaggaccgaggtgaa
tgggatggcctggctccagaggcccgccgagagaaggaggctggcctgcagatgtttggg
cagctggcacgtttccataacatcatgtccaatgaaacaatcggtaccctggccttcctg
acatcagagatcaaatcactttttgtgcatcccttcctggctgagcgcatcatctccatg
ctgaactacttcctgcagcacctggtcggccccaagatgggtgccttaaaagtcaaggac
ttcagtgaatttgacttcaaaccccagcagctcgtatcagacatctgcaccatctactta
aatctcggggatgaggagaatttctgtgccaccgtgcccaaggatggacgatcctattcc
ccaactctctttgcacaaacagtccgagtcctgaagaaaataaataaaccagggaatatg
attgtggcttttagcaacttggcagagagaatcaagtcacttgcagacctgcagcagcag
gaagaggagacctacgctgacgcctgtgacgagttcctggaccccatcatgagcacactg
atgtcggaccctgtggtgctgccgtcctccagagtcaccgtggaccggtccaccatcgcc
agacatttactgagtgaccaaacagatccctttaaccgcagtcccctcaccatggaccag
atccggccaaatacagaactaaaggaaaaaattcaacggtggctcgcagaaaggaagcag
caacaaaaggagcagcttgaataa

DBGET integrated database retrieval system