KEGG   Oryctolagus cuniculus (rabbit): 100353390
Entry
100353390         CDS       T03373                                 

Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353390
   04151 PI3K-Akt signaling pathway
    100353390
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353390
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100353390
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100353390
   04621 NOD-like receptor signaling pathway
    100353390
   04622 RIG-I-like receptor signaling pathway
    100353390
   04623 Cytosolic DNA-sensing pathway
    100353390
   04650 Natural killer cell mediated cytotoxicity
    100353390
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353390
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100353390
   05161 Hepatitis B
    100353390
   05160 Hepatitis C
    100353390
   05171 Coronavirus disease - COVID-19
    100353390
   05164 Influenza A
    100353390
   05162 Measles
    100353390
   05168 Herpes simplex virus 1 infection
    100353390
   05163 Human cytomegalovirus infection
    100353390
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353390
   05169 Epstein-Barr virus infection
    100353390
   05165 Human papillomavirus infection
    100353390
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100353390
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100353390
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100353390
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100353390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353390
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353390
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100353390
NCBI-ProteinID: XP_002708102
UniProt: A0A7R8C371
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcagaggaaatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100354654
Entry
100354654         CDS       T03373                                 

Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354654
   04151 PI3K-Akt signaling pathway
    100354654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354654
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100354654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354654
   04621 NOD-like receptor signaling pathway
    100354654
   04622 RIG-I-like receptor signaling pathway
    100354654
   04623 Cytosolic DNA-sensing pathway
    100354654
   04650 Natural killer cell mediated cytotoxicity
    100354654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354654
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354654
   05161 Hepatitis B
    100354654
   05160 Hepatitis C
    100354654
   05171 Coronavirus disease - COVID-19
    100354654
   05164 Influenza A
    100354654
   05162 Measles
    100354654
   05168 Herpes simplex virus 1 infection
    100354654
   05163 Human cytomegalovirus infection
    100354654
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354654
   05169 Epstein-Barr virus infection
    100354654
   05165 Human papillomavirus infection
    100354654
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100354654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100354654
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100354654
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100354654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354654
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354654
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100354654
NCBI-ProteinID: XP_002708106
Ensembl: ENSOCUG00000027561
UniProt: G1TKA0
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLNDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKKYSPCAWEVVRAEARRAVSLSRI
WQERLWRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcaatgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctttcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
catgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactctgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagattatggcgcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100355669
Entry
100355669         CDS       T03373                                 

Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355669
   04151 PI3K-Akt signaling pathway
    100355669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355669
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355669
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355669
   04621 NOD-like receptor signaling pathway
    100355669
   04622 RIG-I-like receptor signaling pathway
    100355669
   04623 Cytosolic DNA-sensing pathway
    100355669
   04650 Natural killer cell mediated cytotoxicity
    100355669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355669
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355669
   05161 Hepatitis B
    100355669
   05160 Hepatitis C
    100355669
   05171 Coronavirus disease - COVID-19
    100355669
   05164 Influenza A
    100355669
   05162 Measles
    100355669
   05168 Herpes simplex virus 1 infection
    100355669
   05163 Human cytomegalovirus infection
    100355669
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355669
   05169 Epstein-Barr virus infection
    100355669
   05165 Human papillomavirus infection
    100355669
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355669
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355669
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100355669
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100355669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355669
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355669
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100355669
NCBI-ProteinID: XP_002708110
Ensembl: ENSOCUG00000022979
UniProt: A0A7R8GV21
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLACLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEETPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctcttgcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagacacccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcggaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100355912
Entry
100355912         CDS       T03373                                 

Name
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355912
   04151 PI3K-Akt signaling pathway
    100355912
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355912
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355912
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355912
   04621 NOD-like receptor signaling pathway
    100355912
   04622 RIG-I-like receptor signaling pathway
    100355912
   04623 Cytosolic DNA-sensing pathway
    100355912
   04650 Natural killer cell mediated cytotoxicity
    100355912
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355912
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355912
   05161 Hepatitis B
    100355912
   05160 Hepatitis C
    100355912
   05171 Coronavirus disease - COVID-19
    100355912
   05164 Influenza A
    100355912
   05162 Measles
    100355912
   05168 Herpes simplex virus 1 infection
    100355912
   05163 Human cytomegalovirus infection
    100355912
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355912
   05169 Epstein-Barr virus infection
    100355912
   05165 Human papillomavirus infection
    100355912
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355912
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355912
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100355912
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100355912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355912
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355912
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100355912
NCBI-ProteinID: XP_002708111
Ensembl: ENSOCUG00000021123
UniProt: A0A7R8GV81
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356419
Entry
100356419         CDS       T03373                                 

Name
(RefSeq) interferon alpha-14-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356419
   04151 PI3K-Akt signaling pathway
    100356419
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356419
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356419
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356419
   04621 NOD-like receptor signaling pathway
    100356419
   04622 RIG-I-like receptor signaling pathway
    100356419
   04623 Cytosolic DNA-sensing pathway
    100356419
   04650 Natural killer cell mediated cytotoxicity
    100356419
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356419
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356419
   05161 Hepatitis B
    100356419
   05160 Hepatitis C
    100356419
   05171 Coronavirus disease - COVID-19
    100356419
   05164 Influenza A
    100356419
   05162 Measles
    100356419
   05168 Herpes simplex virus 1 infection
    100356419
   05163 Human cytomegalovirus infection
    100356419
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356419
   05169 Epstein-Barr virus infection
    100356419
   05165 Human papillomavirus infection
    100356419
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356419
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356419
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100356419
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100356419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356419
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356419
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100356419
NCBI-ProteinID: XP_002708112
UniProt: A0A7R8GUW1
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLLQTHSLNDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcttcagacccacagcctcaatgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356678
Entry
100356678         CDS       T03373                                 

Name
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356678
   04151 PI3K-Akt signaling pathway
    100356678
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356678
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356678
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356678
   04621 NOD-like receptor signaling pathway
    100356678
   04622 RIG-I-like receptor signaling pathway
    100356678
   04623 Cytosolic DNA-sensing pathway
    100356678
   04650 Natural killer cell mediated cytotoxicity
    100356678
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356678
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356678
   05161 Hepatitis B
    100356678
   05160 Hepatitis C
    100356678
   05171 Coronavirus disease - COVID-19
    100356678
   05164 Influenza A
    100356678
   05162 Measles
    100356678
   05168 Herpes simplex virus 1 infection
    100356678
   05163 Human cytomegalovirus infection
    100356678
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356678
   05169 Epstein-Barr virus infection
    100356678
   05165 Human papillomavirus infection
    100356678
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356678
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356678
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100356678
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100356678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356678
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356678
SSDB
Motif
Pfam: Interferon Ku_C DUF6559
Other DBs
NCBI-GeneID: 100356678
NCBI-ProteinID: XP_002708113
UniProt: A0A7R8GUY5
LinkDB
Position
1
AA seq 189 aa
MASAFCLVLVLVVFNCMSVCALNCDLPQTHSQNNKETFKKLREMRKVMGFFCMQYIHDFG
LPREELEGHQVQKAQTIAVLHEVTQGVFTLFCAPDSSATWNNTILDILCSRLHQQLSDLE
ACVKQEVEVKQTPTIQNPSVRAVNKYFRNIRLYLTEKEDSPCAWMTVTLEVSRAMSLSRF
LQERLRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcggcattttgtcttgtgctggtgctggtagtattcaactgtatgtctgtctgt
gctctgaattgtgatctacctcagactcacagccagaataacaaagaaactttcaagaag
ctgagagaaatgaggaaagtgatgggcttcttctgcatgcagtacattcacgattttggg
ttaccacgggaggagcttgaaggacaccaggtccagaaggctcaaactattgctgtgctg
catgaggtgacccagggggtcttcacacttttctgcgcaccggactcatctgctacctgg
aacaataccatcctggacatactgtgctctagactccaccagcagctgagtgacctggaa
gcctgtgtgaagcaagaagtggaggtgaaacagacacccacgatacagaatccctctgta
cgagctgtgaataagtacttcagaaatatccgcctctatctgacagagaaggaagacagc
ccttgtgcctggatgactgtcacactagaagtttcgagagccatgtctttatcaagattc
ttgcaagaaagattaagaagtaaggattga

KEGG   Oryctolagus cuniculus (rabbit): 100357194
Entry
100357194         CDS       T03373                                 

Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357194
   04151 PI3K-Akt signaling pathway
    100357194
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357194
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357194
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357194
   04621 NOD-like receptor signaling pathway
    100357194
   04622 RIG-I-like receptor signaling pathway
    100357194
   04623 Cytosolic DNA-sensing pathway
    100357194
   04650 Natural killer cell mediated cytotoxicity
    100357194
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357194
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357194
   05161 Hepatitis B
    100357194
   05160 Hepatitis C
    100357194
   05171 Coronavirus disease - COVID-19
    100357194
   05164 Influenza A
    100357194
   05162 Measles
    100357194
   05168 Herpes simplex virus 1 infection
    100357194
   05163 Human cytomegalovirus infection
    100357194
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357194
   05169 Epstein-Barr virus infection
    100357194
   05165 Human papillomavirus infection
    100357194
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357194
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357194
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100357194
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100357194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357194
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357194
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357194
NCBI-ProteinID: XP_002708115
Ensembl: ENSOCUG00000022525
UniProt: G1TMS3
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcctttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100357708
Entry
100357708         CDS       T03373                                 

Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357708
   04151 PI3K-Akt signaling pathway
    100357708
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357708
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357708
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357708
   04621 NOD-like receptor signaling pathway
    100357708
   04622 RIG-I-like receptor signaling pathway
    100357708
   04623 Cytosolic DNA-sensing pathway
    100357708
   04650 Natural killer cell mediated cytotoxicity
    100357708
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357708
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357708
   05161 Hepatitis B
    100357708
   05160 Hepatitis C
    100357708
   05171 Coronavirus disease - COVID-19
    100357708
   05164 Influenza A
    100357708
   05162 Measles
    100357708
   05168 Herpes simplex virus 1 infection
    100357708
   05163 Human cytomegalovirus infection
    100357708
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357708
   05169 Epstein-Barr virus infection
    100357708
   05165 Human papillomavirus infection
    100357708
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357708
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357708
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100357708
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100357708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357708
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357708
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357708
NCBI-ProteinID: XP_002708117
Ensembl: ENSOCUG00000020925
UniProt: G1SHR2
LinkDB
Position
1
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

DBGET integrated database retrieval system