KEGG   Oryctolagus cuniculus (rabbit): 100353573
Entry
100353573         CDS       T03373                                 
Symbol
SMURF1
Name
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04340  Hedgehog signaling pathway
ocu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100353573 (SMURF1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100353573 (SMURF1)
   04350 TGF-beta signaling pathway
    100353573 (SMURF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100353573 (SMURF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353573 (SMURF1)
   04121 Ubiquitin system [BR:ocu04121]
    100353573 (SMURF1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100353573 (SMURF1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100353573 (SMURF1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100353573 (SMURF1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100353573 (SMURF1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100353573 (SMURF1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100353573 (SMURF1)
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 100353573
NCBI-ProteinID: XP_017193346
Ensembl: ENSOCUG00000016326
LinkDB
Position
Un
AA seq 766 aa
NWARWLLCKGSLFTAALQVVFPRAYCKVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHST
DTVKNTLDPKWNQHYDLYVGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAVSRLKDT
GYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRP
LSCFMEEPAPYTDGPGAAGGGGNCRFVESPSQDQRLQAQRLRTPEVRGSLQTPQNRPHGH
QSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRVPSPLGTIPGGDEAFLYEFLLQGHT
AEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCRLKE
PSQPLPLPSEGSVEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEE
SYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCXEMLNPYYGLFQYSTDNSY
MLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESV
DPELHKSLVWILENDITPVLDHTFCVEHNAFGRLLQHELKPNGRNVPVTEENKKEYVRLY
VNWRFMRGIEAQFLALQKGFSELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKH
CVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHL
IDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE
NT seq 2301 nt   +upstreamnt  +downstreamnt
aactgggcaagatggcttctctgtaaaggaagtctcttcacagctgccctgcaagttgtc
ttccccagagcctactgcaaagtgttatgtgccaagaaccttgcaaagaaggacttcttc
cggctcccggacccctttgcgaagatcgtcgtggacgggtctggccagtgccactccacc
gacaccgtgaaaaacacgctggacccaaagtggaaccagcattacgacctgtacgtgggg
aaatcggactccataaccatcagcgtgtggaaccacaagaagattcacaagaagcagggc
gccggcttcctgggctgtgtgcggctgctctccaacgccgtcagccggctgaaagacacc
ggatatcagcgtttggatctatgcaaactaaatccctcggacactgacgcagttcgtggc
caaatagtggtcagtttacagacacgagacaggataggcaccggcgggtccgtggtagac
tgcaggggactactagaaaatgaaggaaccgtgtacgaagactcggggcctgggaggccg
ctcagctgcttcatggaggagccagccccttacacggatggccctggagccgccggcggc
ggcgggaactgcaggttcgtggaatccccgagtcaagatcagagacttcaggcccaacgg
ctgcggactcccgaggtccgaggatcgctccaaacgccacagaaccgaccccacggccac
cagtccccggaactgcccgaaggctacgagcaaagaaccacagtgcaggggcaagtttac
tttctgcacacacagaccggagttagcacgtggcacgacccccgggtacccagtcccttg
gggaccattcctgggggagatgaagcttttctatacgagttccttctccaaggccataca
gctgagcccagagacctcaacagcgtgaactgtgatgagctcggcccgctgccccccggc
tgggaagtcaggagcacggtttcgggcaggatctacttcgtcgaccacaataaccgcacc
acgcagttcacggacccgaggctgcaccacatcatgaatcaccagtgccggctgaaggag
cccagccagcccctgcccttgcccagcgaaggctcggtggaggacgaggagctccctgcc
cagaggtacgaacgcgacctcgtccagaagctcaaagtcctcaggcacgagctgtcgctg
cagcagccgcaggccggccactgccgcatcgaggtttcccgagaagaaatatttgaggag
tcttaccgccagataatgaagatgcgcccgaaggacttgaagaagcggctgatggtgaag
ttccgtggggaggagggcctggattacggcggcgtggcgagggagtggctttacttgctg
tgcnacgagatgctgaacccctactacgggctcttccagtactccacggacaacagctac
atgctgcagatcaaccccgactcctccatcaaccccgaccacttgtcttacttccacttc
gtgggtcggatcatgggcctggccgtgttccacgggcactacatcaacgggggcttcacg
gtccccttctacaagcagctgctggggaagcccatccagctgtcggacctggagtcggtg
gacccggagctgcacaaaagcctggtgtggatcctggagaatgacatcacgccggtgctg
gaccacacgttctgcgtggagcacaatgctttcgggcggctccttcagcatgaactcaag
cccaacggcaggaacgtgcccgtcacggaggagaacaagaaagaatacgtccggctgtac
gtgaactggcggttcatgcgtgggattgaggcccagttcctagccctgcagaagggcttc
agcgagctcatccctcagcacctcctgaagccgttcgaccagaaggagctggagttgatc
ataggcggcctggacaagatcgacttgaacgactggaagtcgaacacgcggctcaagcac
tgcgtggccgacagcaacatcgtgcgctggttctggcaggcggtggagaccttcgacgag
gagcggagggcccggctgctgcagttcgtgacggggtccacgcgcgtgccgctccaaggc
ttcaaggccttgcaaggttccacaggcgccgcagggccccggctgttcaccatccacctg
atagacgccaacacagacaacctccccaaagcgcatacctgctttaaccggatcgacatc
cccccgtatgagtcctacgagaagctctacgagaagctgctgaccgcggtggaggagacc
tgtgggtttgccgtggagtga

KEGG   Oryctolagus cuniculus (rabbit): 100358121
Entry
100358121         CDS       T03373                                 
Symbol
SMURF2
Name
(RefSeq) SMAD specific E3 ubiquitin protein ligase 2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04340  Hedgehog signaling pathway
ocu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100358121 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100358121 (SMURF2)
   04350 TGF-beta signaling pathway
    100358121 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358121 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358121 (SMURF2)
   04121 Ubiquitin system [BR:ocu04121]
    100358121 (SMURF2)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100358121 (SMURF2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100358121 (SMURF2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100358121 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100358121 (SMURF2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100358121 (SMURF2)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100358121 (SMURF2)
SSDB
Motif
Pfam: HECT WW C2 GpA_nuclease HPS3_N
Other DBs
NCBI-GeneID: 100358121
NCBI-ProteinID: XP_017204768
Ensembl: ENSOCUG00000012776
LinkDB
Position
19:complement(49387983..49529233)
AA seq 747 aa
LTPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKW
NQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLG
PNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITR
TTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNY
MSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPP
GWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTE
CLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKR
LMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLS
YFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDI
TGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLAL
QKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNVVKWFWKAVE
FFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRID
IPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2244 nt   +upstreamnt  +downstreamnt
ctaacccccggaggccgacggaacggtcccgtcaagctgcgcctgacagtactctgtgca
aaaaacttggtgaaaaaggattttttccgacttcctgatccatttgctaaagtggtggtt
gatggatctgggcagtgccattctacagatactgtgaagaatacacttgatccaaagtgg
aatcagcattatgatctgtatattggaaagtctgattcagttaccatcagcgtatggaat
cacaagaagatccataaaaaacaaggtgctggatttcttggttgtgttcgtcttctttcc
aatgccatcaatcgcctcaaagacactggttatcagaggttggatctatgcaaacttggg
ccaaatgacaatgatacagttagaggacagatagtagtgagtcttcagtccagagaccga
ataggcacgggaggacaagttgtcgactgcagtcgtttgtttgataatgatttaccagac
ggttgggaagaaaggcgaactgcttctggaagaatccagtatctaaaccacattacaaga
actacacaatgggaacgtccaacacgaccggcgtctgaatattctagtcctggcagacct
cttagctgctttgttgatgagaacactccaattagtggaacaaatggtgcaacatgtgga
cagtcttcagaccccagactggcagagaggagggtcaggtcacagcgtcatagaaattac
atgagcaggacacacttacatactcctccagacctcccagaaggctatgaacagaggaca
acgcaacaaggtcaggtgtatttcttacatactcagactggtgtgagtacatggcatgat
ccaagagtgcctagggatcttagcaacatcaattgtgaagagcttgggcctttgcctcct
ggatgggagatccgtaatacagctacaggcagagtttatttcgttgaccataacaacaga
acaacacaatttacagatcctcggctctctgctaacttgcatttagttttaaaccggcaa
aaccagttaaaagatcaacagcaacagcaagtggtgtcattatgccctgatgacacagag
tgtctgacagtcccaaggtacaaacgagacctggttcagaaactaaaaattttgcggcaa
gaactctctcagcagcagcctcaggctggccactgtcgcattgaggtttccagggaggag
atttttgaggaatcatatcggcaggttatgaaaatgagaccaaaagatctgtggaagcga
ttaatgataaaatttcgtggagaagaaggtcttgactatggaggggttgccagggaatgg
ttgtatctcctgtcacatgaaatgttgaatccatactatggccttttccagtattcaaga
gatgatatctatacgttgcagataaatcctgattctgcagtaaacccggagcatttatca
tatttccactttgttggacgaataatgggaatggctgtgtttcatggacattacattgac
ggtggcttcacactgccgttttataaacagttacttgggaagtcaattactttggatgac
atggagttggttgatccagatcttcataacagtttagtgtggatacttgaaaatgatatt
acaggtgttttggaccataccttctgtgttgaacataatgcatatggtgaaattattcag
catgaacttaagccaaatggcaaaagtatacctgttactgaagaaaataaaaaagaatat
gtcaggctgtatgtgaactggagatttttacgaggcattgaggctcaattcctggctcta
cagaaaggatttaatgaagtcattccacagcatctgctgaagacatttgatgaaaaggag
ttagagctcattatttgcggacttggaaagatagatgttaatgactggaaggtaaacacc
aggttgaaacactgcacaccagacagcaatgtggtcaagtggttctggaaagctgtggaa
ttttttgatgaagagcgacgagcgcgattacttcagtttgtgacagggtcatccagagtg
cctctccagggcttcaaagcgttacagggtgctgcgggcccgcggctcttcaccattcac
cagattgatgcctgcaccaacaatctgccaaaagcccacacttgcttcaatcgaatagac
attccgccctatgaaagctatgaaaagctctatgaaaagctgctaacagccatcgaagaa
acatgtggatttgctgtggaatga

DBGET integrated database retrieval system