Oryctolagus cuniculus (rabbit): 100353697 Help Entry 100353697         CDS       T03373                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04024   cAMP signaling pathway ocu04080   Neuroactive ligand-receptor interaction ocu04081   Hormone signaling ocu04935   Growth hormone synthesis, secretion and action ocu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     100353697   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100353697    04081 Hormone signaling     100353697  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100353697   09154 Digestive system    04971 Gastric acid secretion     100353697  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100353697 Cytokines and neuropeptides [BR:ocu04052]  Neuropeptides   GPCR binding    100353697 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  100353697 NCBI-ProteinID:  XP_002716545 Ensembl:  ENSOCUG00000007564 UniProt:  G1STB4 LinkDB All DBs Position 14:complement(84420738..84422304) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDDMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgtcgcctgcagtgcgcgctggccgcgctctccatcgtcctggctctgggc ggtgtcaccggagcgccttcggaccctaggctccgtcagtttctgcagaagtccctggcg gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgagccc aaccagacggagaatgatgccctggaacctgaagatctgtcccaggctgctgagcaggat gacatgaggctggagctgcagagatctgcgaactcaaacccggctatggccccccgagag cgcaaggctggctgcaagaacttcttctggaagactttcacatcatgttag

DBGET integrated database retrieval system