KEGG   Oryctolagus cuniculus (rabbit): 100353755
Entry
100353755         CDS       T03373                                 
Symbol
NCK2
Name
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04360  Axon guidance
ocu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100353755 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100353755 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100353755 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100353755
NCBI-ProteinID: XP_002709736
Ensembl: ENSOCUG00000025486
UniProt: G1U3C3
LinkDB
Position
2:complement(86456662..86598023)
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVRNLKDTLGLGKTRRKPSARDASPTPSTDAEYPSNGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEADEAAAESPSFL
SLRKGASLSNGQGARVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPSHALPISYTGPASSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagtgattgttatcgccaagtgggactacacggcccagcaggaccaggag
cttgacatcaagaagaacgagcgcctgtggctgctggacgactccaagacgtggtggcgg
gtgcgcaacgcggccaacaggacgggctacgtgccctccaactacgtggagcgcaagaac
agcctgaagaagggctccctcgtgaggaacctcaaggacacgctgggccttggcaagacc
cgcaggaagccgagcgcgcgcgacgcgtccccgacgcccagcaccgatgcagagtacccc
tccaacggcagcggcgccgaccgcatctacgacctcaacatccctgccttcgtcaagttc
gcctatgtggccgagagggaggatgagctgtcgctggtgaagggctcgcgcgtcacggtc
atggagaagtgcagcgacggctggtggcgcggcagctacaacgggcagatcggctggttc
ccgtccaactacgtgctggaggaggcggacgaggcggcggccgagtcccccagcttcctc
agcctgcgcaagggcgcctcgctgagcaacggccagggcgcgcgggtgctgcacgtggtg
cagacgctgtaccccttcagctcggtcacggaggaggagctcaacttcgagaagggagag
accatggaggtgatcgagaaacccgagaacgaccccgagtggtggaaatgcaaaaacgcc
cggggccaggtgggcctcgtgcccaaaaactacgtggtggtcctgagcgacgggccggcc
ctgcacccctcgcacgccctgcccatcagctacaccgggccggcgtccagcgggcgcttc
gcgggccgcgagtggtactacggcaacgtgacgcgccaccaggccgagtgcgcactcaac
gagcggggcgtggaaggcgacttcctcatcagggatagcgagtcctcgcccagcgacttc
tccgtgtctctcaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtgtactgcattgggcagcggcgattccacaccatggacgagctggtggaacactacaaa
aaggcccccatcttcaccagcgagcacggggagaagctctacctcgtccgggcgctgcag
tga

DBGET integrated database retrieval system