KEGG   Oryctolagus cuniculus (rabbit): 100353950
Entry
100353950         CDS       T03373                                 
Symbol
IL19
Name
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353950 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353950 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100353950 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353950 (IL19)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100353950 (IL19)
SSDB
Motif
Pfam: IL10 Cas5fv_helical
Other DBs
NCBI-GeneID: 100353950
NCBI-ProteinID: XP_002717483
Ensembl: ENSOCUG00000014272
LinkDB
Position
16:complement(65519479..65525709)
AA seq 177 aa
MKVQGVPLWLLGITFVLCSGHLRGLRRCPISMDMRHLQESFQDIQRAIQANDTFQNITIL
SALDSLQGIKPLDVCCVTRSLLAFYMDRVFKDHQEPDPHILRRISSIANSFLYMQKTVQQ
CQVQGRCHCREEATNVTQIIHNNYNQLEARVAAVKSLGELNVFLAWISENYQDGSAA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggtgcagggtgtccccctctggctcctgggcatcacgtttgtcctgtgctcaggg
cacctccgtggtctcaggagatgtccgatctccatggacatgcgccacctgcaagagagt
ttccaagacatccaaagagccatacaagccaatgacaccttccaaaacatcaccatcctg
tctgcactggacagcctgcagggcattaagccgttagatgtgtgctgcgtgaccaggagc
ctcctggcgttctacatggacagggtgttcaaggaccaccaggagccggacccgcacatc
ttgaggcgaatcagcagcattgccaactccttcctctacatgcagaagaccgtgcagcag
tgtcaggtgcagggacggtgtcactgcagggaggaagccaccaacgtgacccaaatcatt
cacaacaactataatcagttggaggcccgcgtggctgccgtcaagtccttgggagagctc
aatgtctttctggcctggatcagcgagaattaccaagacggctctgctgcctga

DBGET integrated database retrieval system