KEGG   Oryctolagus cuniculus (rabbit): 100353960
Entry
100353960         CDS       T03373                                 
Symbol
UBE2G1
Name
(RefSeq) ubiquitin conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100353960 (UBE2G1)
   04120 Ubiquitin mediated proteolysis
    100353960 (UBE2G1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100353960 (UBE2G1)
   05022 Pathways of neurodegeneration - multiple diseases
    100353960 (UBE2G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100353960 (UBE2G1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100353960 (UBE2G1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100353960 (UBE2G1)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100353960
NCBI-ProteinID: XP_017204311
LinkDB
Position
19:14217690..14322097
AA seq 285 aa
MAAARAPARSSGRGRHRWGPTGGLKEGSGRVKSQCAPRRPGYPPLPGVRRCEKSRAQRLA
SATRRHHCRPSPASLCFGAPSAGPGFLSTPSSSRPQSLSPALRTPRRQPGPLAGRMTELQ
SALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDY
PLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVI
SMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcggctgccagggccccggcgcgcagcagtggccggggaaggcaccggtggggcccg
acgggcgggttgaaggagggaagcgggcgagtgaagtcccagtgcgcgccgcggcggccc
gggtatcctccccttccgggcgtgaggcgctgtgagaagagccgagcccagcgactagca
tcggcaacgaggcgccaccactgccgccccagcccggcctccctctgcttcggcgctccg
tccgcggggcccgggttcctcagcacacccagctccagccgcccccagagcctgtcccca
gctctccgaacgccccggcggcagcctgggcccttggcggggaggatgacggagctgcag
tcggcgctgctactgcgaagacagctggcagaactcaacaaaaatccagtggaaggcttt
tcagcaggtttaatagatgacaatgatctctaccgatgggaagtccttattattggtcct
ccagatacactatatgaaggtggtgtttttaaggctcacctcacttttccaaaggattat
cccctccggcctcctaaaatgaaattcattacagaaatctggcacccaaatgttgataaa
aatggtgatgtttgcatttctattcttcatgagcctggggaagataaatatggttatgaa
aagccagaggaacgttggctgcctatccatactgtggaaaccatcatgataagtgtcatt
tctatgctggcagaccctaatggagactcaccagctaatgttgatgccgcgaaagaatgg
agggaagacagaaatggagaatttaaaaggaaagttgcccgctgtgtaagaaaaagccaa
gagactgctttcgagtga

DBGET integrated database retrieval system