KEGG   Oryctolagus cuniculus (rabbit): 100354066
Entry
100354066         CDS       T03373                                 
Symbol
RAB35
Name
(RefSeq) RAB35, member RAS oncogene family
  KO
K07876  Ras-related protein Rab-35
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100354066 (RAB35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100354066 (RAB35)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100354066 (RAB35)
   04031 GTP-binding proteins [BR:ocu04031]
    100354066 (RAB35)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100354066 (RAB35)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100354066 (RAB35)
  Exosomal proteins of other body fluids (saliva and urine)
   100354066 (RAB35)
  Exosomal proteins of colorectal cancer cells
   100354066 (RAB35)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    100354066 (RAB35)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 PduV-EutP RsgA_GTPase Gtr1_RagA FeoB_N AAA_22 AAA_16 AAA AAA_29 SRPRB AAA_24 MCM TniB AAA_5 Dioxygenase_N AAA_23 NACHT DUF3873 ABC_tran
Other DBs
NCBI-GeneID: 100354066
NCBI-ProteinID: XP_008270529
Ensembl: ENSOCUG00000014600
LinkDB
Position
21:12450833..12461962
AA seq 201 aa
MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ
IWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGN
KNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ
QQQQNDVVKLTKNSKRKKRCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcccgggactacgaccacctcttcaagctgctcatcatcggcgacagcggtgtgggc
aagagcagtttactgttgcgttttgcagacaacactttctcaggcagctacatcaccacg
attggagtggacttcaagattcgtacggtggagatcaatggagagaaagtgaagctgcag
atctgggacacggcaggccaggagcgcttccgcaccatcacatccacgtattaccggggg
acccacggggtcattgtggtttatgatgtcaccagtgccgagtcctttgtgaacgtcaag
cggtggcttcatgaaatcaaccagaactgtgacgatgtgtgccgaatactagtgggcaac
aagaatgacgaccctgagcggaaggtggtggagacagaagatgcctacaaatttgctggg
cagatggggatccagttgtttgagaccagtgccaaggagaacgtcaacgtggaagagatg
ttcaactgcatcacagagctggtcctccgagccaagaaagacaacctggccaaacagcag
cagcagcagcagaacgacgtggtgaagctcacgaagaacagtaaacgaaagaaacgctgc
tgctaa

DBGET integrated database retrieval system