KEGG   Oryctolagus cuniculus (rabbit): 100354464
Entry
100354464         CDS       T03373                                 
Symbol
ZFYVE27
Name
(RefSeq) zinc finger FYVE-type containing 27
  KO
K19368  protrudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100354464 (ZFYVE27)
SSDB
Motif
Pfam: FYVE FYVE_2
Other DBs
NCBI-GeneID: 100354464
NCBI-ProteinID: XP_002718653
Ensembl: ENSOCUG00000001352
LinkDB
Position
18:45890744..45915535
AA seq 411 aa
MQTSERERSGPEVSPSLMPEAPLESPPAPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQMPLCSLLTCLGLNILFLTLNAGAWYSVGALMISVPALLGYLQEVCRARLPES
ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAHRVLHWENPV
VSSQFYGALLGTVCMLYLLPLCWVFALLNSTLFLGNVEFFRVVSEYRASLQRWMHPRQED
PAPQSLPPPDAAGKAALLDSTPAPTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLE
DDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVL
KKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcagacatcagagcgggagcggagtgggccggaggtgagccccagcctgatgcctgag
gcccccctggagtctcctccagctcctaccaagtcgccagcgtttgatcttttcaacttg
gttctgtcctacaagaggctggagatctacctggaacccctgaaggatgcgggtgatggc
gtccgatacttgctcaggtggcagatgcctctgtgttccttgctgacttgcctgggcctc
aacatcctgttcctcaccttgaatgcgggtgcgtggtactcggtgggtgccttgatgatt
tccgtgccagccctgctgggctaccttcaggaggtctgccgagcccggctgcctgagtcg
gagctgatgcggaggaagtatcacagcgtgaggcaggaggacctgcagagggtgcgcctc
tctcgccccgaggctgtggctgaggtgaagagcttcttgatccagctggaggccttcctg
agccgcctgtgctgcacctgcgaagctgcccaccgcgtgcttcactgggagaaccctgtg
gtgtcctcacagttctatggagctcttttgggcacagtttgcatgttgtatctgctgccg
ctctgctgggtctttgcccttttaaacagcacactctttctggggaatgtggagttcttc
cgagtggtgtctgagtacagagcatctctgcagcggtggatgcaccccaggcaggaggac
cctgctccccagagtctgcccccaccagatgctgcggggaaggctgctctgctggacagc
acgcccgcccctacgcccacggaggacctcacgccaggcagcgtggaggaggctgaagag
gcggagccagatgaggagtttaaagacgcgattgaggagacccatttggtggtgttggag
gatgacgagggagccccgtgcccggcggaagatgagctagccctgcaggacaacgggttc
ctgagcaagaatgaggtgctgcgcagcaaggtgtcacggctcacggagcggctccgcaag
cgctaccctaccaacaacttcgggaactgcacaggctgctctgctaccttctcagtgctg
aagaagaggcggagctgcagtaactgtggaaacagcttttgctctcggtgctgctccttc
aaggtgcccaagtcttccatgggggccacagcccctgaagcccaaagagagactgtgttt
gtgtgtgcatcgtgtaaccagaccttgagcaagtga

DBGET integrated database retrieval system