KEGG   Oryctolagus cuniculus (rabbit): 100354471
Entry
100354471         CDS       T03373                                 
Symbol
WAS
Name
(RefSeq) Wiskott-Aldrich syndrome
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu05135  Yersinia infection
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100354471 (WAS)
   04530 Tight junction
    100354471 (WAS)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100354471 (WAS)
   04062 Chemokine signaling pathway
    100354471 (WAS)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100354471 (WAS)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100354471 (WAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100354471 (WAS)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100354471 (WAS)
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100354471 (WAS)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100354471 (WAS)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100354471 (WAS)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH1 domain-containing proteins
   100354471 (WAS)
SSDB
Motif
Pfam: WH1 PBD WH2
Other DBs
NCBI-GeneID: 100354471
NCBI-ProteinID: XP_008270806
Ensembl: ENSOCUG00000015393
UniProt: A0A5F9CE91
LinkDB
Position
X:33344362..33362263
AA seq 500 aa
MSGGPVGGRPGGRGAPEVKQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRKSGDRRQLPPPPAPANEERRGGLPPLPSH
PGGDQGGPQTGPLSLGLVTVDIQNPDITSSRYRGLPAPAPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPPPPPSRGGNQPPRPPLAGGNKGRSGPLPPVPLGGAPPPPTPRGPPPPG
RGGPPPPPPPATGRSGPPPPPPPGAGGPAIPPPPPPPPPPPPSSGDGPVPPPPPLAPLSG
GCMASGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQTSEGLVGALMHVMQKRSRAIH
SSDEGEDQAGDEDEDDEWDD
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgagtgggggccctgtgggaggcaggcccgggggtcgaggagcacctgaggttaagcag
aacattccctccaccctgcttcaggaccacgagaaccagcgactcttcgagatgcttgga
cgaaaatgctggacgctggccactgcagttgttcagctgtacctggcgctgccccctgga
gccgagcactggaccaaggagcattgtggggctgtgtgcttcgtgaaggataacccccag
aagtcctacttcatccgcctttacggccttcaggctggccggctgctctgggaacaggag
ctgtactcacagctggtctactccactcccacccccttcttccacacctttgccggagat
gactgccaagcgggcctgaactttgcagatgagggtgaggcccaggccttccgggccctg
gtgcaagagaagatacaaaaaaggaatcagaggaaaagtggagacagacggcagctaccc
ccaccaccagcaccagccaatgaagagagaagaggggggctcccacccttgccctcacac
ccaggtggagaccaagggggcccacaaactggcccactgtccttggggctggtgacagtg
gacatccagaatcctgacatcacaagttcacgataccgtgggctcccagcacctgctcct
ggcccagctgataagaaacgctctggaaagaagaagatcagcaaagcagatattggggca
cccagtggattcaaacatgtcagccacgtggggtgggacccccagaacggatttgacgtg
aacaacctggacccggatctgcggagcctgttctccagggcaggaatcagtgaggctcaa
ctcactgatgcagagacctccaaactcatctacgacttcattgaggaccagggcgggctg
gaggctgtgcggcaggagatgaggcgtcaagagccgcccccaccgccatctcgaggaggg
aaccagccccccagaccacctctggcggggggtaacaagggccgttctggtccactaccc
cctgtacctttagggggcgctccgcccccacccacgccccgaggacccccacccccaggc
cgagggggccctccaccaccaccccctccagccactggccgctctggaccaccgccccct
ccgccccctggagctgggggaccagccattccacctcccccgccccctcccccaccgcca
ccccccagctccggggatgggccagtgcctcccccgcccccacttgctccgctgtctggg
ggttgcatggcctctggagggggtcggggggcgcttttggatcaaatccggcagggaatt
cagctgaacaagactcccggggccccagagagctcagccctgcagccgccaccgcagacc
tccgaggggctggtgggcgccctgatgcacgtgatgcagaaaagaagcagggccatccac
tcttccgacgaaggagaggaccaggccggcgatgaggatgaagacgacgagtgggacgac
tga

DBGET integrated database retrieval system