KEGG   Oryctolagus cuniculus (rabbit): 100354643
Entry
100354643         CDS       T03373                                 
Symbol
CTF1
Name
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354643 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354643 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354643 (CTF1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100354643 (CTF1)
SSDB
Motif
Pfam: CNTF NolB LIF_OSM PRF
Other DBs
NCBI-GeneID: 100354643
NCBI-ProteinID: XP_008246936
LinkDB
Position
Un
AA seq 199 aa
MSRREGSLEDPQAASSVPGLPHLEAKIRQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPRLPVAGLSAPAPSLRGAAGAERLQLDAAALAGLPPLLDAVRRRQAELNPRAPRLLR
RLEDAARQVRALGAAVETVLAALGAADPGPRPEPPATAAAAAAGTFQAKVLGLRVCGLCR
EWVSRTEGDLGPLLPGGPA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagatccccaggctgcctcctcagtcccgggtctt
ccccacttggaggccaagatccggcagacacacagcctagcccgcctcctcaccaaatac
gcggagcagctgctccaggaatatgtgcagcatcagggcgaccccttcgggctgccgggc
ttctcgccaccgcggctgcccgtggccggcctgagcgccccggccccgagcctacgaggg
gctgccggagccgagcggctgcagctggacgcggcggcgctcgcggggctgcccccgctg
ttggacgccgtgcgccgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgg
cgcctggaggacgcggcgcgccaggtccgggccctgggcgccgccgtggagaccgtgctg
gcggcgctgggtgccgccgacccggggccccggccggagccgcccgccaccgccgccgcc
gccgccgcgggcaccttccaggccaaggtgctggggctccgcgtgtgcggcctctgccgc
gagtgggtgagccgcaccgagggcgacctgggcccgctgctgcccggcggcccggcctga

KEGG   Oryctolagus cuniculus (rabbit): 108175610
Entry
108175610         CDS       T03373                                 
Name
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108175610
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108175610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108175610
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   108175610
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 108175610
NCBI-ProteinID: XP_017193235
LinkDB
Position
Un
AA seq 203 aa
MSGRLAPLCLLALLLPPLRPAAPLSPAEPISQAYSLALYMQKNTSTLLQTYLQHQGSPFS
DPGFSAPELQLSSLPPATVSFKVWHALDDGERLSRAQEAFLALTQHLQLVGDDQSDLNPD
SPILLAQLSAARLRAQGLLGNMAAIMAALGLPIPKEEDTLGLVPFGASAFERKCRGYVVT
REYGHWTDRVVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagcgggcggctggccccgctgtgcctgctggccctgctgctgcccccgctccggccc
gcggcccccctgtccccagctgagcccatcagccaagcctacagcctggcgctgtacatg
cagaagaatacatcgacgctactccagacctacctccagcaccagggcagccccttcagc
gatcccggcttctcagccccggagctccagctcagcagcctgccccctgctacggtctcc
ttcaaggtctggcacgccctggatgacggggagcggctgagccgggcccaggaggccttc
ctggccctgacccaacacctgcagctcgtgggcgacgaccagagcgacctgaatcctgac
agtcccatcctgctggcccagctcagcgctgcaagactcagggcccaaggccttctgggc
aacatggctgccatcatggccgccctggggctgcctatacccaaggaagaggacactctt
ggacttgtcccctttggggcctccgccttcgagaggaaatgtcgaggctacgtggtaacc
cgggaatatggtcactggacagaccgggttgtgagggacttggctctgctcaaggccaaa
tacccagcctag

DBGET integrated database retrieval system